Mouse PRKDC Monoclonal Antibody | anti-PRKDC antibody

PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350) (AP)

Cat. Num. AAA6162826

• Gene Names: PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PRKDC; Monoclonal Antibody; PRKDC (Protein Kinase; DNA-Activated; Catalytic Polypeptide; DNA-PKcs; DNAPK; DNPK1; HYRC; HYRC1; XRCC7; p350) (AP); Protein Kinase; p350; anti-PRKDC antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A8
• Specificity: Recognizes PRKDC.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 4128

• Applicable Applications for anti-PRKDC antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRKDC (NP_008835, 4019aa-4128aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PRKDC monoclonal antibody (M03), clone 2A8 Western Blot analysis of PRKDC expression in Hela S3 NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

Related Product Information for anti-PRKDC antibody

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties. [supplied by OMIM]

Product Categories/Family for anti-PRKDC antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13654237
• NCBI GeneID: 5591
• NCBI Accession #: NP_008835
• NCBI GenBank Nucleotide #: NP_008835.5
• UniProt Accession #: P78527
• NCBI Official Full Name: DNA-dependent protein kinase catalytic subunit isoform 1
• NCBI Official Synonym Full Names: protein kinase, DNA-activated, catalytic subunit
• NCBI Official Symbol: PRKDC
• NCBI Official Synonym Symbols: HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
• NCBI Protein Information: DNA-dependent protein kinase catalytic subunit
• UniProt Protein Name: DNA-dependent protein kinase catalytic subunit
• UniProt Gene Name: PRKDC
• UniProt Synonym Gene Names: HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs
• UniProt Entry Name: PRKDC_HUMAN

NCBI Description

This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.[provided by RefSeq, Jul 2010]

Uniprot Description

DNAPK: an atypical protein kinase of the PIKK family. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. and modulation of transcription. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Defects cause severe combined immune deficiency (SCID) which is characterized by a lack of mature functional lymphocytes and a high susceptibility to lethal opportunistic infections. Required for repair of radiation-induced dsDNA breaks. Loss of function in mice or horses leads to the SCID (severe combined immune deficiency) phenotype due to failure of immunoglobulin rearrangement. Target of mutation in mismatch repair-deficient colorectal cancer. Inhibitor: KU-7059. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Nucleolus; Protein kinase, atypical; EC 2.7.11.1; DNA repair, damage; Protein kinase, Ser/Thr (non-receptor); ATYPICAL group; PIKK family; DNAPK subfamily

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: nucleoplasm; transcription factor complex; membrane; nucleolus; DNA-dependent protein kinase complex; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; enzyme binding; DNA binding; DNA-dependent protein kinase activity; transcription factor binding; ATP binding; protein kinase activity

Biological Process: positive regulation of apoptosis; heart development; germ cell programmed cell death; T cell differentiation in the thymus; rhythmic process; double-strand break repair via nonhomologous end joining; negative regulation of protein amino acid phosphorylation; double-strand break repair; positive regulation of interferon type I production; response to gamma radiation; telomere maintenance; pro-B cell differentiation; somitogenesis; protein destabilization; immunoglobulin V(D)J recombination; B cell lineage commitment; protein modification process; regulation of circadian rhythm; DNA repair; double-strand break repair via homologous recombination; T cell lineage commitment; peptidyl-serine phosphorylation; DNA damage response, signal transduction resulting in induction of apoptosis; cellular response to insulin stimulus; innate immune response; T cell receptor V(D)J recombination; positive regulation of transcription from RNA polymerase II promoter; brain development

Disease: Immunodeficiency 26 With Or Without Neurologic Abnormalities