Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SDF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Rabbit SDF4 Polyclonal Antibody | anti-SDF4 antibody

SDF4 antibody - middle region

Gene Names
SDF4; Cab45; SDF-4
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SDF4; Polyclonal Antibody; SDF4 antibody - middle region; anti-SDF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE
Sequence Length
348
Applicable Applications for anti-SDF4 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SDF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SDF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-SDF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-SDF4 antibody
This is a rabbit polyclonal antibody against SDF4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Product Categories/Family for anti-SDF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
45 kDa calcium-binding protein isoform 1
NCBI Official Synonym Full Names
stromal cell derived factor 4
NCBI Official Symbol
SDF4
NCBI Official Synonym Symbols
Cab45; SDF-4
NCBI Protein Information
45 kDa calcium-binding protein
UniProt Protein Name
45 kDa calcium-binding protein
UniProt Gene Name
SDF4
UniProt Synonym Gene Names
CAB45; PSEC0034; Cab45; SDF-4
UniProt Entry Name
CAB45_HUMAN

NCBI Description

This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium dependent cellular activities. [provided by RefSeq, Sep 2011]

Uniprot Description

SDF4: May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. Belongs to the CREC family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: Golgi apparatus; membrane; Golgi lumen; cytoplasm; late endosome; plasma membrane

Molecular Function: identical protein binding; protein binding; calcium ion binding

Biological Process: fat cell differentiation; response to ethanol; UV protection; cerebellum development; calcium ion-dependent exocytosis

Research Articles on SDF4

Similar Products

Product Notes

The SDF4 sdf4 (Catalog #AAA3208481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDF4 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SDF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDF4 sdf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTHFRAVDPD GDGHVSWDEY KVKFLASKGH SEKEVADAIR LNEELKVDEE. It is sometimes possible for the material contained within the vial of "SDF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.