Mouse TLR5 Monoclonal Antibody | anti-TLR5 antibody

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (AP)

Cat. Num. AAA6161766

• Gene Names: TLR5; SLE1; TIL3; SLEB1; MELIOS
• Applications: ELISA
• Purity: Purified
• Synonyms: TLR5; Monoclonal Antibody; TLR5 (Toll-like Receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3) (AP); Toll-like Receptor 5; TIL3; anti-TLR5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 10
• Specificity: Recognizes TLR5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TLR5 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TLR5 (NP_003259, 517aa-634aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TLR5 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-TLR5 antibody

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. [provided by RefSeq]

Product Categories/Family for anti-TLR5 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 16751843
• NCBI GeneID: 7100
• NCBI Accession #: NP_003259
• NCBI GenBank Nucleotide #: NM_003268.5
• UniProt Accession #: O60602; O15456; Q32MI2; Q32MI3; B1AZ05; B3Y633; B9VJ63; D1CS80; D3DTB8
• Molecular Weight: 97,834 Da
• NCBI Official Full Name: toll-like receptor 5
• NCBI Official Synonym Full Names: toll-like receptor 5
• NCBI Official Symbol: TLR5
• NCBI Official Synonym Symbols: SLE1; TIL3; SLEB1; MELIOS
• NCBI Protein Information: toll-like receptor 5; toll/interleukin-1 receptor-like protein 3; systemic lupus erythematosus susceptibility 1
• UniProt Protein Name: Toll-like receptor 5
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR5
• UniProt Synonym Gene Names: TIL3
• UniProt Entry Name: TLR5_HUMAN

NCBI Description

This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.[provided by RefSeq, Dec 2009]

Uniprot Description

TLR5: Participates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Genetic variation in TLR5 is associated with resistance to systemic lupus erythematosus type 1 (SLEB1). Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q41-q42

Cellular Component: integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity; interleukin-1 receptor binding

Biological Process: toll-like receptor 5 signaling pathway; positive regulation of interleukin-8 production; MyD88-dependent toll-like receptor signaling pathway; regulation of cytokine secretion; positive regulation of nitric oxide biosynthetic process; male gonad development; defense response to bacterium; toll-like receptor signaling pathway; innate immune response; inflammatory response; positive regulation of toll-like receptor signaling pathway; toll-like receptor 10 signaling pathway

Disease: Legionnaire Disease, Susceptibility To; Systemic Lupus Erythematosus, Susceptibility To, 1; Melioidosis, Susceptibility To