Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse BLK Monoclonal Antibody | anti-BLK antibody

BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (PE)

Gene Names
BLK; MODY11
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
BLK; Monoclonal Antibody; BLK (B lymphoid Tyrosine Kinase; MGC10442; BLK Nonreceptor Tyrosine Kinase) (PE); anti-BLK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7A12
Specificity
Recognizes human BLK. Species Crossreactivity: mouse and rat
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
505
Applicable Applications for anti-BLK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-90 from human BLK with GST tag (AAH07371). MW of the GST tag alone is 26kD.
Immunogen Sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPP LPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMND RDLQMLKGEKLQVLKG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BLK antibody
Non-receptor tyrosine kinase involved in B-lymphocyte development, differentiation and signaling. B-cell receptor (BCR) signaling requires a tight regulation of several protein tyrosine kinases and phosphatases, and associated coreceptors. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. Signaling through BLK plays an important role in transmitting signals through surface immunoglobulins and supports the pro-B to pre-B transition, as well as the signaling for growth arrest and apoptosis downstream of B-cell receptor. Specifically binds and phosphorylates CD79A at 'Tyr-188'and 'Tyr-199', as well as CD79B at 'Tyr-196' and 'Tyr-207'. Phosphorylates also the immunoglobulin G receptors FCGR2A, FCGR2B and FCGR2C. With FYN and LYN, plays an essential role in pre-B-cell receptor (pre-BCR)-mediated NF-kappa-B activation. Contributes also to BTK activation by indirectly stimulating BTK intramolecular autophosphorylation. In pancreatic islets, acts as a modulator of beta-cells function through the up-regulation of PDX1 and NKX6-1 and consequent stimulation of insulin secretion in response to glucose.
Product Categories/Family for anti-BLK antibody
References
1. BANK1 and BLK Act through Phospholipase C Gamma 2 in B-Cell Signaling. Bernal-Quiros M, Wu YY, Alarcon-Riquelme ME, Castillejo-Lopez C PLoS One. 2013; 8(3):e59842. doi: 10.1371/journal. pone. 0059842. Epub 2013 Mar 26. 2. Genetic and physical interaction of the B-cell systemic lupus erythematosus-associated genes BANK1 and BLK. Castillejo-Lopez C, Delgado-Vega AM, Wojcik J, Kozyrev SV, Thavathiru E, Wu YY, Sanchez E, Pollmann D, Lopez-Egido JR, Fineschi S, Dominguez N, Lu R, James JA, Merrill JT, Kelly JA, Kaufman KM, Moser KL, Gilkeson G, Frostegard J, Pons-Estel BA, D'Alfonso S, Witte T, Callejas JL, Harley JB, Gaffney PM, Martin J, Guthridge JM, Alarcon-Riquelme ME. Ann Rheum Dis. 2011 Oct 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
640
NCBI Official Full Name
B lymphoid tyrosine kinase
NCBI Official Synonym Full Names
BLK proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
BLK
NCBI Official Synonym Symbols
MODY11
NCBI Protein Information
tyrosine-protein kinase Blk
Protein Family

NCBI Description

This gene encodes a nonreceptor tyrosine-kinase of the src family of proto-oncogenes that are typically involved in cell proliferation and differentiation. The protein has a role in B-cell receptor signaling and B-cell development. The protein also stimulates insulin synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors. [provided by RefSeq, Aug 2010]

Research Articles on BLK

Similar Products

Product Notes

The BLK (Catalog #AAA6161269) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BLK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BLK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BLK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.