Testing Data
(Detection limit for recombinant GST tagged ZMYND10 is 0.03ng/ml using MBS6003637 as a capture antibody.)
Mouse anti-Human ZMYND10 Monoclonal Antibody | anti-ZMYND10 antibody
ZMYND10 (Zinc Finger MYND Domain-containing 10, BLUORF, FLU, LUCA12.4, Protein BLu) (PE)
Gene Names
ZMYND10; BLU; FLU
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZMYND10; Monoclonal Antibody; ZMYND10 (Zinc Finger MYND Domain-containing 10; BLUORF; FLU; LUCA12.4; Protein BLu) (PE); anti-ZMYND10 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D11
Specificity
Recognizes human ZMYND10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ZMYND10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa341-441 from human ZMYND10 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LERENRGKWQAIAKHQLQHVFSPSEQDLWLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ZMYND10 is 0.03ng/ml using MBS6003637 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ZMYND10 is 0.03ng/ml using MBS6003637 as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6003637 (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6003637 (37.11kD).)
Western Blot (WB)
(Western Blot analysis of ZMYND10 expression in transfected 293T cell line using MBS6003637 Lane 1: ZMYND10 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ZMYND10 expression in transfected 293T cell line using MBS6003637 Lane 1: ZMYND10 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ZMYND10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,344 Da
NCBI Official Full Name
zinc finger MYND domain-containing protein 10
NCBI Official Synonym Full Names
zinc finger, MYND-type containing 10
NCBI Official Symbol
ZMYND10
NCBI Official Synonym Symbols
BLU; FLU
NCBI Protein Information
zinc finger MYND domain-containing protein 10; protein BLu; zinc finger, MYND domain containing 10
UniProt Protein Name
Zinc finger MYND domain-containing protein 10
Protein Family
UniProt Gene Name
ZMYND10
UniProt Synonym Gene Names
BLU
UniProt Entry Name
ZMY10_HUMAN
Similar Products
Product Notes
The ZMYND10 zmynd10 (Catalog #AAA6161143) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZMYND10 (Zinc Finger MYND Domain-containing 10, BLUORF, FLU, LUCA12.4, Protein BLu) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZMYND10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZMYND10 zmynd10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZMYND10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
