Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)

Mouse anti-Human ZHX3 Monoclonal Antibody | anti-ZHX3 antibody

ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1) (PE)

Gene Names
ZHX3; TIX1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZHX3; Monoclonal Antibody; ZHX3 (Zinc Fingers and Homeoboxes Protein 3; Zinc Finger and Homeodomain Protein 3; KIAA0395; Triple Homeobox Protein 1; TIX1) (PE); anti-ZHX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D9
Specificity
Recognizes human ZHX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
10006
Applicable Applications for anti-ZHX3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa863-955 from ZHX3 (NP_055850) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLET*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZHX3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZHX3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ZHX3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZHX3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZHX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens zinc fingers and homeoboxes 3 (ZHX3), mRNA
NCBI Official Synonym Full Names
zinc fingers and homeoboxes 3
NCBI Official Symbol
ZHX3
NCBI Official Synonym Symbols
TIX1
NCBI Protein Information
zinc fingers and homeoboxes protein 3
UniProt Protein Name
Zinc fingers and homeoboxes protein 3
UniProt Gene Name
ZHX3
UniProt Synonym Gene Names
KIAA0395; TIX1
UniProt Entry Name
ZHX3_HUMAN

NCBI Description

This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. [provided by RefSeq, Jul 2008]

Uniprot Description

ZHX3: Acts as a transcriptional repressor. Involved in the early stages of mesenchymal stem cell (MSC) osteogenic differentiation. Is a regulator of podocyte gene expression during primary glomerula disease. Binds to promoter DNA. Belongs to the ZHX family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; metal ion binding; transcription factor activity; transcription corepressor activity

Biological Process: positive regulation of osteoblast differentiation; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell differentiation

Research Articles on ZHX3

Similar Products

Product Notes

The ZHX3 zhx3 (Catalog #AAA6161135) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZHX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZHX3 zhx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZHX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.