Mouse anti-Human SRP68 Monoclonal Antibody | anti-SRP68 antibody

SRP68 (Signal Recognition Particle 68kD Protein) (PE)

Cat. Num. AAA6160495

• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SRP68; Monoclonal Antibody; SRP68 (Signal Recognition Particle 68kD Protein) (PE); anti-SRP68 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A3
• Specificity: Recognizes human SRP68.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SRP68 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa531-628 from human SRP68 (NP_055045) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SRP68 monoclonal antibody. Western Blot analysis of SRP68 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SRP68 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SRP68 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-SRP68 antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 24497620
• NCBI GeneID: 6730
• NCBI Accession #: NP_055045.2
• NCBI GenBank Nucleotide #: NM_014230
• UniProt Accession #: Q9UHB9; Q8NCJ4; Q8WUK2; B3KUU5; B3KWY7; G3V1U4
• Molecular Weight: 66,108 Da
• NCBI Official Full Name: signal recognition particle subunit SRP68 isoform 1
• NCBI Official Synonym Full Names: signal recognition particle 68
• NCBI Official Symbol: SRP68
• NCBI Protein Information: signal recognition particle subunit SRP68
• UniProt Protein Name: Signal recognition particle subunit SRP68
• Protein Family: Signal recognition particle
• UniProt Gene Name: SRP68
• UniProt Synonym Gene Names: SRP68
• UniProt Entry Name: SRP68_HUMAN

NCBI Description

This gene encodes a subunit of the signal recognition particle (SRP). The SRP is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. The encoded protein is the 68kDa component of the SRP, and forms a heterodimer with the 72kDa subunit that is required for SRP function. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and three pseudogenes of this gene are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, May 2012]

Uniprot Description

SRP68: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function. Belongs to the SRP68 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: focal adhesion; endoplasmic reticulum; cytoplasm; nucleolus; signal recognition particle, endoplasmic reticulum targeting; ribosome; cytosol

Molecular Function: signal recognition particle binding; signal sequence binding; endoplasmic reticulum signal peptide binding; 7S RNA binding

Biological Process: response to drug; protein targeting to ER; SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; gene expression