Mouse anti-Human SIN3B Monoclonal Antibody | anti-SIN3B antibody

SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b) (PE)

Cat. Num. AAA6160273

• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SIN3B; Monoclonal Antibody; SIN3B (Paired Amphipathic Helix Protein Sin3b; Histone Deacetylase Complex Subunit Sin3b; KIAA0700; Transcriptional Corepressor Sin3b) (PE); anti-SIN3B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C11
• Specificity: Recognizes human SIN3B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 5134

• Applicable Applications for anti-SIN3B antibody: ELISA (EIA)
• Application Notes: ELISA: 3 ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1063-1161 from SIN3B (NP_056075) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SIN3B is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-SIN3B antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1677500234
• NCBI GeneID: 23309
• NCBI Accession #: NM_015260.4
• NCBI GenBank Nucleotide #: NM_015260
• UniProt Accession #: O75182
• NCBI Official Full Name: Homo sapiens SIN3 transcription regulator family member B (SIN3B), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: SIN3 transcription regulator family member B
• NCBI Official Symbol: SIN3B
• NCBI Protein Information: paired amphipathic helix protein Sin3b
• UniProt Protein Name: Paired amphipathic helix protein Sin3b
• Protein Family: Paired amphipathic helix protein
• UniProt Gene Name: SIN3B
• UniProt Synonym Gene Names: KIAA0700
• UniProt Entry Name: SIN3B_HUMAN

Uniprot Description

SIN3B: Acts as a transcriptional repressor. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. Also forms a complex with FOXK1 which represses transcription. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; Y chromosome; XY body; autosome; Sin3 complex; X chromosome; cytoplasm; nucleus

Molecular Function: protein binding; chromatin binding; histone deacetylase activity

Biological Process: cardiac muscle development; skeletal muscle development; transcription, DNA-dependent; histone deacetylation; cellular lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter