Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLAU AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit PLAU Polyclonal Antibody | anti-PLAU antibody

PLAU antibody - C-terminal region

Gene Names
PLAU; ATF; QPD; UPA; URK; u-PA; BDPLT5
Reactivity
Horse, Human, Rabbit, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLAU; Polyclonal Antibody; PLAU antibody - C-terminal region; anti-PLAU antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Sequence Length
431
Applicable Applications for anti-PLAU antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Rabbit: 86%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLAU AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-PLAU AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-PLAU antibody
This is a rabbit polyclonal antibody against PLAU. It was validated on Western Blot

Target Description: This gene encodes a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in this gene may be associated with late-onset Alzheimer's disease and also with decreased affinity for fibrin-binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg-Val bond in plasminogen. Plasmin in turn cleaves this protein at a Lys-Ile bond to form a two-chain derivative in which a single disulfide bond connects the amino-terminal A-chain to the catalytically active, carboxy-terminal B-chain. This two-chain derivative is also called HMW-uPA (high molecular weight uPA). HMW-uPA can be further processed into LMW-uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino-terminal fragment. LMW-uPA is proteolytically active but does not bind to the uPA receptor.
Product Categories/Family for anti-PLAU antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
urokinase-type plasminogen activator isoform 1 preproprotein
NCBI Official Synonym Full Names
plasminogen activator, urokinase
NCBI Official Symbol
PLAU
NCBI Official Synonym Symbols
ATF; QPD; UPA; URK; u-PA; BDPLT5
NCBI Protein Information
urokinase-type plasminogen activator
UniProt Protein Name
Urokinase-type plasminogen activator
UniProt Gene Name
PLAU
UniProt Synonym Gene Names
U-plasminogen activator; uPA
UniProt Entry Name
UROK_HUMAN

NCBI Description

This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

uPA: Specifically cleave the zymogen plasminogen to form the active enzyme plasmin. Defects in PLAU are the cause of Quebec platelet disorder (QPD). QPD is an autosomal dominant bleeding disorder due to a gain-of-function defect in fibrinolysis. Although affected individuals do not exhibit systemic fibrinolysis, they show delayed onset bleeding after challenge, such as surgery. The hallmark of the disorder is markedly increased PLAU levels within platelets, which causes intraplatelet plasmin generation and secondary degradation of alpha-granule proteins. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; EC 3.4.21.73; Protease; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q22.2

Cellular Component: extracellular space; focal adhesion; cell surface; plasma membrane; extracellular region

Molecular Function: protein binding; serine-type endopeptidase activity

Biological Process: fibrinolysis; regulation of cell adhesion mediated by integrin; regulation of smooth muscle cell migration; smooth muscle cell migration; response to hypoxia; regulation of receptor activity; chemotaxis; blood coagulation; proteolysis; signal transduction; regulation of cell proliferation

Disease: Quebec Platelet Disorder; Alzheimer Disease

Research Articles on PLAU

Similar Products

Product Notes

The PLAU plau (Catalog #AAA3216150) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLAU antibody - C-terminal region reacts with Horse, Human, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PLAU can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLAU plau for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSLQGRMTLT GIVSWGRGCA LKDKPGVYTR VSHFLPWIRS HTKEENGLAL. It is sometimes possible for the material contained within the vial of "PLAU, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.