Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human 2019-09-09 Monoclonal Antibody | anti-SEPT9 antibody

SEPT9 (Septin-9, MLL Septin-like Fusion Protein MSF-A, MLL Septin-like Fusion Protein, Ovarian/Breast Septin, Ov/Br Septin, Septin D1, KIAA0991, MSF) (PE)

Gene Names
SEPTIN9; MSF; MSF1; NAPB; SEPT9; SINT1; PNUTL4; SeptD1; AF17q25
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-09-09; Monoclonal Antibody; SEPT9 (Septin-9; MLL Septin-like Fusion Protein MSF-A; MLL Septin-like Fusion Protein; Ovarian/Breast Septin; Ov/Br Septin; Septin D1; KIAA0991; MSF) (PE); anti-SEPT9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C6
Specificity
Recognizes human SEPT9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3692
Applicable Applications for anti-SEPT9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-125 from human SEPT9 (AAH21192) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged SEPT9 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEPT9 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SEPT9 antibody
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.
Product Categories/Family for anti-SEPT9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens septin 9, mRNA
NCBI Official Synonym Full Names
septin 9
NCBI Official Symbol
SEPTIN9
NCBI Official Synonym Symbols
MSF; MSF1; NAPB; SEPT9; SINT1; PNUTL4; SeptD1; AF17q25
NCBI Protein Information
septin-9

NCBI Description

This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009]

Research Articles on SEPT9

Similar Products

Product Notes

The SEPT9 (Catalog #AAA6160191) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEPT9 (Septin-9, MLL Septin-like Fusion Protein MSF-A, MLL Septin-like Fusion Protein, Ovarian/Breast Septin, Ov/Br Septin, Septin D1, KIAA0991, MSF) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-09-09 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEPT9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-09-09, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.