Mouse anti-Human RORC Monoclonal Antibody | anti-RORC antibody

RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (PE)

Cat. Num. AAA6160015

• Gene Names: RORC; TOR; RORG; RZRG; IMD42; NR1F3; RZR-GAMMA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RORC; Monoclonal Antibody; RORC (Nuclear Receptor ROR-gamma; Nuclear Receptor RZR-gamma; Nuclear Receptor Subfamily 1 Group F Member 3; Retinoid-related Orphan Receptor-gamma; NR1F3; RORG; RZRG) (PE); anti-RORC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G7
• Specificity: Recognizes human RORC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RORC antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa412-518, from human RORC (NP_005051) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RORC monoclonal antibody. Western Blot analysis of RORC expression in human kidney.)

Testing Data

(Detection limit for recombinant GST tagged RORC is 1ng/ml as a capture antibody.)

Related Product Information for anti-RORC antibody

RORg (Nuclear receptor ROR-gamma) is a member of the NR1 nuclear hormone receptor family. RORg is a DNA binding transcription factor. RORg is 518aa in length. Kockout mice implicate RORg as being essential for lymphoid organogenesis and controlling apoptosis during thymopoiesis. Two splice forms differing in the first 24aa have been found for this gene, isoform 2 deletes aa1-21 resulting in an alteration of aa22-24. Over aa1-100 human RORC shares 96% identity with mouse RORg.

Product Categories/Family for anti-RORC antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 19743909
• NCBI GeneID: 6097
• NCBI Accession #: NP_005051
• NCBI GenBank Nucleotide #: NM_005060
• UniProt Accession #: P51449
• Molecular Weight: 58kDa
• NCBI Official Full Name: nuclear receptor ROR-gamma isoform a
• NCBI Official Synonym Full Names: RAR related orphan receptor C
• NCBI Official Symbol: RORC
• NCBI Official Synonym Symbols: TOR; RORG; RZRG; IMD42; NR1F3; RZR-GAMMA
• NCBI Protein Information: nuclear receptor ROR-gamma
• UniProt Protein Name: Nuclear receptor ROR-gamma
• Protein Family: Nuclear receptor
• UniProt Gene Name: RORC
• UniProt Synonym Gene Names: NR1F3; RORG; RZRG
• UniProt Entry Name: RORG_HUMAN

NCBI Description

The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

RORC: Possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. Involved in lineage specification of uncommitted CD4(+) T-helper cells into Th17 cells. Regulate the expression of several components of the circadian clock. Belongs to the nuclear hormone receptor family. NR1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Transcription factor

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; oxysterol binding; transcription factor activity

Biological Process: Peyer's patch development; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; T-helper cell differentiation; regulation of fat cell differentiation; positive regulation of transcription, DNA-dependent; T cell differentiation in the thymus; positive regulation of circadian rhythm; lymph node development; protein amino acid phosphorylation; regulation of gamma-delta T cell differentiation; xenobiotic metabolic process; regulation of steroid metabolic process; steroid hormone mediated signaling; gene expression; circadian regulation of gene expression