Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human RIPK4 Monoclonal Antibody | anti-RIPK4 antibody

RIPK4 (Receptor-interacting Serine/Threonine-protein Kinase 4, Ankyrin Repeat Domain-containing Protein 3, PKC-delta-interacting Protein Kinase, ANKRD3, DIK, MGC129992, MGC129993) (PE)

Gene Names
RIPK4; DIK; PKK; PPS2; RIP4; ANKK2; NKRD3; ANKRD3; CHANDS
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RIPK4; Monoclonal Antibody; RIPK4 (Receptor-interacting Serine/Threonine-protein Kinase 4; Ankyrin Repeat Domain-containing Protein 3; PKC-delta-interacting Protein Kinase; ANKRD3; DIK; MGC129992; MGC129993) (PE); anti-RIPK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D1
Specificity
Recognizes human RIPK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RIPK4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa675-785 from human RIPK4 (NP_065690) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(RIPK4 monoclonal antibody, Western Blot analysis of RIPK4 expression in A-431.)

Western Blot (WB) (RIPK4 monoclonal antibody, Western Blot analysis of RIPK4 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RIPK4 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RIPK4 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RIPK4 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RIPK4 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-RIPK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 4
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 4
NCBI Official Symbol
RIPK4
NCBI Official Synonym Symbols
DIK; PKK; PPS2; RIP4; ANKK2; NKRD3; ANKRD3; CHANDS
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 4
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 4
UniProt Gene Name
RIPK4
UniProt Synonym Gene Names
ANKRD3; DIK
UniProt Entry Name
RIPK4_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq, Jul 2008]

Uniprot Description

ANKRD3: a TKL protein kinase of the RIPK family. Activates NFkappaB when overexpressed in cell lines and is required for keratinocyte differentiation in vivo. Appears to activate NFkappaB in both a kinase-dependent as well as a kinase-independent manner. Contains 10 ANK repeats. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Protein kinase, TKL; Kinase, protein; TKL group; RIPK family

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: membrane; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: morphogenesis of an epithelium; protein amino acid phosphorylation; activation of NF-kappaB transcription factor

Disease: Popliteal Pterygium Syndrome, Lethal Type

Research Articles on RIPK4

Similar Products

Product Notes

The RIPK4 ripk4 (Catalog #AAA6159952) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RIPK4 (Receptor-interacting Serine/Threonine-protein Kinase 4, Ankyrin Repeat Domain-containing Protein 3, PKC-delta-interacting Protein Kinase, ANKRD3, DIK, MGC129992, MGC129993) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RIPK4 ripk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIPK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.