Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RFXANK is ~3ng/ml as a capture antibody.)

Mouse anti-Human RFXANK Monoclonal Antibody | anti-RFXANK antibody

RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) (PE)

Gene Names
RFXANK; BLS; RFX-B; ANKRA1; F14150_1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RFXANK; Monoclonal Antibody; RFXANK (DNA-binding Protein RFXANK; Ankyrin Repeat Family A Protein 1; Regulatory Factor X Subunit B; RFX-B; Regulatory Factor X-associated Ankyrin-containing Protein; ANKRA1; RFXB; F14150_1; MGC138628) (PE); anti-RFXANK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes human RFXANK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
260
Applicable Applications for anti-RFXANK antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from RFXANK (NP_003712) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RFXANK is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RFXANK is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)
Product Categories/Family for anti-RFXANK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA-binding protein RFXANK isoform a
NCBI Official Synonym Full Names
regulatory factor X associated ankyrin containing protein
NCBI Official Symbol
RFXANK
NCBI Official Synonym Symbols
BLS; RFX-B; ANKRA1; F14150_1
NCBI Protein Information
DNA-binding protein RFXANK
UniProt Protein Name
DNA-binding protein RFXANK
Protein Family
UniProt Gene Name
RFXANK
UniProt Synonym Gene Names
ANKRA1; RFXB; RFX-B

NCBI Description

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator/CIITA. May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters (PubMed:9806546, PubMed:10072068, PubMed:10725724). May also potentiate the activation of RAF1 ().

Research Articles on RFXANK

Similar Products

Product Notes

The RFXANK rfxank (Catalog #AAA6159914) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RFXANK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RFXANK rfxank for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RFXANK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.