Mouse anti-Human RFXANK Monoclonal Antibody | anti-RFXANK antibody

RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) APC

Cat. Num. AAA6138702

• Gene Names: RFXANK; BLS; RFX-B; ANKRA1; F14150_1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RFXANK; Monoclonal Antibody; RFXANK (DNA-binding Protein RFXANK; Ankyrin Repeat Family A Protein 1; Regulatory Factor X Subunit B; RFX-B; Regulatory Factor X-associated Ankyrin-containing Protein; ANKRA1; RFXB; F14150_1; MGC138628) APC; anti-RFXANK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G10
• Specificity: Recognizes human RFXANK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 260

• Applicable Applications for anti-RFXANK antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-90 from RFXANK (NP_003712) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RFXANK is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Product Categories/Family for anti-RFXANK antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4506499
• NCBI GeneID: 8625
• NCBI Accession #: NP_003712.1
• NCBI GenBank Nucleotide #: NM_003721
• UniProt Accession #: O14593
• NCBI Official Full Name: DNA-binding protein RFXANK isoform a
• NCBI Official Synonym Full Names: regulatory factor X associated ankyrin containing protein
• NCBI Official Symbol: RFXANK
• NCBI Official Synonym Symbols: BLS; RFX-B; ANKRA1; F14150_1
• NCBI Protein Information: DNA-binding protein RFXANK
• UniProt Protein Name: DNA-binding protein RFXANK
• Protein Family: DNA-binding protein
• UniProt Gene Name: RFXANK
• UniProt Synonym Gene Names: ANKRA1; RFXB; RFX-B

NCBI Description

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator/CIITA. May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters (PubMed:9806546, PubMed:10072068, PubMed:10725724). May also potentiate the activation of RAF1 ().