Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody. Lane 1: RAD1 transfected lysate (32.43kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RAD1 Monoclonal Antibody | anti-RAD1 antibody

RAD1 (Cell Cycle Checkpoint Protein RAD1, hRAD1, DNA Repair Exonuclease Rad1 Homolog, Rad1-like DNA Damage Checkpoint Protein, REC1) (PE)

Gene Names
RAD1; REC1; HRAD1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD1; Monoclonal Antibody; RAD1 (Cell Cycle Checkpoint Protein RAD1; hRAD1; DNA Repair Exonuclease Rad1 Homolog; Rad1-like DNA Damage Checkpoint Protein; REC1) (PE); anti-RAD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G2
Specificity
Recognizes human RAD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RAD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90, from human RAD1 (AAH06837) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody. Lane 1: RAD1 transfected lysate (32.43kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody. Lane 1: RAD1 transfected lysate (32.43kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAD1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAD1 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAD1 over-expressed 293 cell line, cotransfected with RAD1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RAD1 over-expressed 293 cell line, cotransfected with RAD1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
7,576 Da
NCBI Official Full Name
Homo sapiens RAD1 homolog (S. pombe), mRNA
NCBI Official Synonym Full Names
RAD1 checkpoint DNA exonuclease
NCBI Official Symbol
RAD1
NCBI Official Synonym Symbols
REC1; HRAD1
NCBI Protein Information
cell cycle checkpoint protein RAD1
Protein Family

NCBI Description

This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009]

Research Articles on RAD1

Similar Products

Product Notes

The RAD1 (Catalog #AAA6159805) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD1 (Cell Cycle Checkpoint Protein RAD1, hRAD1, DNA Repair Exonuclease Rad1 Homolog, Rad1-like DNA Damage Checkpoint Protein, REC1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.