Mouse anti-Human POLR1B Monoclonal Antibody | anti-POLR1B antibody

POLR1B (DNA-directed RNA Polymerase I Subunit RPA2, DNA-directed RNA Polymerase I 135kD Polypeptide, FLJ10816, FLJ21921, MGC131780) (PE)

Cat. Num. AAA6159560

• Gene Names: POLR1B; RPA2; RPA135; Rpo1-2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLR1B; Monoclonal Antibody; POLR1B (DNA-directed RNA Polymerase I Subunit RPA2; DNA-directed RNA Polymerase I 135kD Polypeptide; FLJ10816; FLJ21921; MGC131780) (PE); anti-POLR1B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes human POLR1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-POLR1B antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa963-1073 from human POLR1B (NP_061887) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POLR1B on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-POLR1B antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 33469941
• NCBI GeneID: 84172
• NCBI Accession #: NP_061887
• NCBI GenBank Nucleotide #: NM_019014
• UniProt Accession #: Q9H9Y6
• Molecular Weight: 128kDa
• NCBI Official Full Name: DNA-directed RNA polymerase I subunit RPA2 isoform 1
• NCBI Official Synonym Full Names: RNA polymerase I subunit B
• NCBI Official Symbol: POLR1B
• NCBI Official Synonym Symbols: RPA2; RPA135; Rpo1-2
• NCBI Protein Information: DNA-directed RNA polymerase I subunit RPA2
• UniProt Protein Name: DNA-directed RNA polymerase I subunit RPA2
• UniProt Gene Name: POLR1B
• UniProt Synonym Gene Names: RNA polymerase I subunit 2; RPA135
• UniProt Entry Name: RPA2_HUMAN

NCBI Description

Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).[supplied by OMIM, Mar 2008]

Uniprot Description

POLR1B: a subunit of RNA polymerase I (Pol I), a DNA-dependent RNA polymerase that synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the clef. Two alternatively spliced human isoforms have been described.

Protein type: Transcription initiation complex; Nucleotide Metabolism - pyrimidine; EC 2.7.7.6; Nucleolus; Nucleotide Metabolism - purine; Transferase

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: nucleoplasm; cytoplasm; nucleolus; DNA-directed RNA polymerase I complex

Molecular Function: protein binding; DNA binding; ribonucleoside binding; metal ion binding

Biological Process: negative regulation of gene expression, epigenetic; nucleologenesis; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; embryo implantation; rRNA transcription