Mouse anti-Human PNPLA2 Monoclonal Antibody | anti-PNPLA2 antibody

PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglyceride Lipase, ATGL, Calcium-independent Phospholipase A2, Desnutrin, DKFZp667M109, FP17548, IPLA2-zeta, Patatin-like Phospholipase Domain-containing Protein 2 Pig

Cat. Num. AAA6159549

• Gene Names: PNPLA2; ATGL; TTS2; PEDF-R; FP17548; TTS-2.2; iPLA2zeta; 1110001C14Rik
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PNPLA2; Monoclonal Antibody; PNPLA2 (PEDFR; Patatin-like Phospholipase Domain Containing 2; 1110001C14Rik; Adipose Triglyceride Lipase; ATGL; Calcium-independent Phospholipase A2; Desnutrin; DKFZp667M109; FP17548; IPLA2-zeta; Patatin-like Phospholipase Domain-containing Protein 2 Pig; anti-PNPLA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H1
• Specificity: Recognizes human PNPLA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PNPLA2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa347-447 from human PNPLA2 (NP_065109) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PNPLA2 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-PNPLA2 antibody

Triglycerides are the most efficient form of energy storage in mammalian adipose tissue during times of caloric excess. ATGL is one of the key enzymes involved in the mobilization of fatty acids from triglyceride stores in adipose tissue, catalyzing the conversion of triacylglycerols to diacylglycerols. Inhibition of ATGL markedly decreases total adipose acyl-hydrolase activity, and thus may be a potential drug target for the diabetic pathology. ATGL mRNA is detected in a wide range of tissues including adipose, lung, skeletal muscle, testis, heart, brain, and kidney, with adipose tissue expressing the highest level.

Product Categories/Family for anti-PNPLA2 antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 32698724
• NCBI GeneID: 57104
• NCBI Accession #: NP_065109
• NCBI GenBank Nucleotide #: NM_020376
• UniProt Accession #: Q96AD5; O60643; Q5EFF5; Q6XYE5; Q96ET6; Q9NQ61; Q9NQ62
• Molecular Weight: 19,875 Da
• NCBI Official Full Name: patatin-like phospholipase domain-containing protein 2
• NCBI Official Synonym Full Names: patatin like phospholipase domain containing 2
• NCBI Official Symbol: PNPLA2
• NCBI Official Synonym Symbols: ATGL; TTS2; PEDF-R; FP17548; TTS-2.2; iPLA2zeta; 1110001C14Rik
• NCBI Protein Information: patatin-like phospholipase domain-containing protein 2
• UniProt Protein Name: Patatin-like phospholipase domain-containing protein 2
• Protein Family: Patatin-like phospholipase domain-containing protein
• UniProt Gene Name: PNPLA2
• UniProt Synonym Gene Names: ATGL; TTS2

NCBI Description

This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy. [provided by RefSeq, Jul 2010]

Uniprot Description

Catalyzes the initial step in triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets (PubMed:15550674). Also has acylglycerol transacylase activity. May act coordinately with LIPE/HLS within the lipolytic cascade. Regulates adiposome size and may be involved in the degradation of adiposomes (PubMed:16239926). May play an important role in energy homeostasis. May play a role in the response of the organism to starvation, enhancing hydrolysis of triglycerides and providing free fatty acids to other tissues to be oxidized in situations of energy depletion.