Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human Phosphodiesterase 8A Monoclonal Antibody | anti-PDE8A antibody

Phosphodiesterase 8A (PDE8A, High Affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic Phosphodiesterase 8A, FLJ16150, HsT19550) (PE)

Gene Names
PDE8A; HsT19550
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Phosphodiesterase 8A; Monoclonal Antibody; Phosphodiesterase 8A (PDE8A; High Affinity cAMP-specific and IBMX-insensitive 3'; 5'-cyclic Phosphodiesterase 8A; FLJ16150; HsT19550) (PE); anti-PDE8A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H6
Specificity
Recognizes human PDE8A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PDE8A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-122 from human PDE8A (NP_002596) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(Western Blot analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody. Lane 1: PDE8A transfected lysate (93.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody. Lane 1: PDE8A transfected lysate (93.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PDE8A is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDE8A is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PDE8A antibody
Phosphodiesterase 8A, a high affinity, cAMP-specific phosphodiesterase, has been implicated in penile erectile dysfunction. PDE8A activity is inhibited by dipyridamole, but not by rolipram, zaprinast, or IBMX. At least five splice variants and four protein isoforms have been reported.
Product Categories/Family for anti-PDE8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86,049 Da
NCBI Official Full Name
high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 8A
NCBI Official Symbol
PDE8A
NCBI Official Synonym Symbols
HsT19550
NCBI Protein Information
high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
UniProt Protein Name
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
UniProt Gene Name
PDE8A
UniProt Entry Name
PDE8A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

Research Articles on PDE8A

Similar Products

Product Notes

The PDE8A pde8a (Catalog #AAA6159439) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Phosphodiesterase 8A (PDE8A, High Affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic Phosphodiesterase 8A, FLJ16150, HsT19550) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Phosphodiesterase 8A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE8A pde8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Phosphodiesterase 8A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.