Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human NR4A3 Monoclonal Antibody | anti-NR4A3 antibody

NR4A3 (Nuclear Receptor Subfamily 4 Group A Member 3, Mitogen-induced Nuclear Orphan Receptor, Neuron-derived Orphan Receptor 1, Nuclear Hormone Receptor NOR-1, CHN, CSMF, MINOR, NOR1, TEC) (PE)

Gene Names
NR4A3; CHN; TEC; CSMF; NOR1; MINOR
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR4A3; Monoclonal Antibody; NR4A3 (Nuclear Receptor Subfamily 4 Group A Member 3; Mitogen-induced Nuclear Orphan Receptor; Neuron-derived Orphan Receptor 1; Nuclear Hormone Receptor NOR-1; CHN; CSMF; MINOR; NOR1; TEC) (PE); anti-NR4A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E9
Specificity
Recognizes human NR4A3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
626
Applicable Applications for anti-NR4A3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa414-522 from NR4A3 (NP_008912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NR4A3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NR4A3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-NR4A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclear receptor subfamily 4 group A member 3 isoform a
NCBI Official Synonym Full Names
nuclear receptor subfamily 4 group A member 3
NCBI Official Symbol
NR4A3
NCBI Official Synonym Symbols
CHN; TEC; CSMF; NOR1; MINOR
NCBI Protein Information
nuclear receptor subfamily 4 group A member 3
UniProt Protein Name
Nuclear receptor subfamily 4 group A member 3
UniProt Gene Name
NR4A3
UniProt Synonym Gene Names
CHN; CSMF; MINOR; NOR1; TEC
UniProt Entry Name
NR4A3_HUMAN

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

NR4A3: Binds to the B1A response-element. Defects in NR4A3 are a cause of Ewing sarcoma (ES). A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. A chromosomal aberration involving NR4A3 is found in patients with Erwing sarcoma. Translocation t(9;22)(q22-31;q11-12) with EWSR1. A chromosomal aberration involving NR4A3 is a cause of a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with TAF2N. Belongs to the nuclear hormone receptor family. NR4 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; thyroid hormone receptor activity

Biological Process: response to peptide hormone stimulus; axon guidance; transcription initiation from RNA polymerase II promoter; organ regeneration; intracellular receptor-mediated signaling pathway; hippocampus development; semicircular canal morphogenesis; positive regulation of cell cycle; response to hydrogen peroxide; mesoderm formation; vestibular reflex; adult behavior; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; negative regulation of neuron apoptosis; neuromuscular process controlling balance

Disease: Chondrosarcoma, Extraskeletal Myxoid

Research Articles on NR4A3

Similar Products

Product Notes

The NR4A3 nr4a3 (Catalog #AAA6159168) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR4A3 (Nuclear Receptor Subfamily 4 Group A Member 3, Mitogen-induced Nuclear Orphan Receptor, Neuron-derived Orphan Receptor 1, Nuclear Hormone Receptor NOR-1, CHN, CSMF, MINOR, NOR1, TEC) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR4A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR4A3 nr4a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR4A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.