Mouse anti-Human NCAPH Monoclonal Antibody | anti-NCAPH antibody

NCAPH (BRRN, BRRN1, CAPH, KIAA0074, Condensin Complex Subunit 2, Barren Homolog Protein 1, Chromosome-associated Protein H, Non-SMC Condensin I Complex Subunit H, XCAP-H Homolog) (PE)

Cat. Num. AAA6159011

• Gene Names: NCAPH; BRRN1; CAP-H
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCAPH; Monoclonal Antibody; NCAPH (BRRN; BRRN1; CAPH; KIAA0074; Condensin Complex Subunit 2; Barren Homolog Protein 1; Chromosome-associated Protein H; Non-SMC Condensin I Complex Subunit H; XCAP-H Homolog) (PE); anti-NCAPH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C9
• Specificity: Recognizes human BRRN1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NCAPH antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa645-741 from BRRN1 (AAH24211) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB)

(BRRN1 monoclonal antibody Western Blot analysis of BRRN1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of NCAPH expression in transfected 293T cell line by NCAPH monoclonal antibody. Lane 1: NCAPH transfected lysate (Predicted MW: 82.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged BRRN1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NCAPH antibody

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Product Categories/Family for anti-NCAPH antibody

Antibodies; KIAA; orf

NCBI and Uniprot Product Information

• NCBI GI #: 38197468
• NCBI GeneID: 23397
• Molecular Weight: 67,495 Da
• NCBI Official Full Name: Homo sapiens non-SMC condensin I complex, subunit H, mRNA
• NCBI Official Synonym Full Names: non-SMC condensin I complex subunit H
• NCBI Official Symbol: NCAPH
• NCBI Official Synonym Symbols: BRRN1; CAP-H
• NCBI Protein Information: condensin complex subunit 2
• Protein Family: Condensin complex

NCBI Description

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. Alternatively spliced transcript variants encoding different proteins have been described. [provided by RefSeq, Jul 2013]