Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.81kD).)

Mouse anti-Human LASS6 Monoclonal Antibody | anti-LASS6 antibody

LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950) (PE)

Gene Names
CERS6; CERS5; LASS6
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LASS6; Monoclonal Antibody; LASS6 (LAG1 Longevity Assurance Homolog 6; LAG1 Homolog Ceramide Synthase 6; CerS6; MGC129949; MGC129950) (PE); anti-LASS6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5H7
Specificity
Recognizes human LASS6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LASS6 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa62-132 from human LASS6 (NP_982288) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.81kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.81kD).)

Western Blot (WB)

(LASS6 monoclonal antibody Western Blot analysis of LASS6 expression in HeLa.)

Western Blot (WB) (LASS6 monoclonal antibody Western Blot analysis of LASS6 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LASS6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LASS6 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-LASS6 antibody
References
1. D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells. Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S.Biochimie. 2011 May 7. 2. Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells. Mesicek J, Lee H, Feldman T, Jiang X, Skobeleva A, Berdyshev EV, Haimovitz-Friedman A, Fuks Z, Kolesnick R.Cell Signal. 2010 Apr 18. 3. Acid ceramidase 1 expression correlates with a better prognosis in ER-positive breast cancer. Ruckhaberle E, Holtrich U, Engels K, Hanker L, Gatje R, Metzler D, Karn T, Kaufmann M, Rody A.Climacteric. 2009 Jul 31:1-12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ceramide synthase 6 isoform 1
NCBI Official Synonym Full Names
ceramide synthase 6
NCBI Official Symbol
CERS6
NCBI Official Synonym Symbols
CERS5; LASS6
NCBI Protein Information
ceramide synthase 6; LAG1 homolog, ceramide synthase 6; longevity assurance homolog 6

Research Articles on LASS6

Similar Products

Product Notes

The LASS6 (Catalog #AAA6158580) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LASS6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LASS6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LASS6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.