Mouse anti-Human LASS6 Monoclonal Antibody | anti-LASS6 antibody

LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950) (HRP)

Cat. Num. AAA6153277

• Gene Names: CERS6; CERS5; LASS6
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LASS6; Monoclonal Antibody; LASS6 (LAG1 Longevity Assurance Homolog 6; LAG1 Homolog Ceramide Synthase 6; CerS6; MGC129949; MGC129950) (HRP); anti-LASS6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5H7
• Specificity: Recognizes human LASS6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LASS6 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa62-132 from human LASS6 (NP_982288) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.81kD).)

Western Blot (WB)

(LASS6 monoclonal antibody Western Blot analysis of LASS6 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LASS6 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-LASS6 antibody

Antibodies; Enzymes; Synthase

References

1. D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells. Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S.Biochimie. 2011 May 7. 2. Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells. Mesicek J, Lee H, Feldman T, Jiang X, Skobeleva A, Berdyshev EV, Haimovitz-Friedman A, Fuks Z, Kolesnick R.Cell Signal. 2010 Apr 18. 3. Acid ceramidase 1 expression correlates with a better prognosis in ER-positive breast cancer. Ruckhaberle E, Holtrich U, Engels K, Hanker L, Gatje R, Metzler D, Karn T, Kaufmann M, Rody A.Climacteric. 2009 Jul 31:1-12.

NCBI and Uniprot Product Information

• NCBI GI #: 371122599
• NCBI GeneID: 253782
• NCBI Accession #: NP_982288
• NCBI GenBank Nucleotide #: NM_203463
• NCBI Official Full Name: ceramide synthase 6 isoform 1
• NCBI Official Synonym Full Names: ceramide synthase 6
• NCBI Official Symbol: CERS6
• NCBI Official Synonym Symbols: CERS5; LASS6
• NCBI Protein Information: ceramide synthase 6; LAG1 homolog, ceramide synthase 6; longevity assurance homolog 6