Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human IL4 Monoclonal Antibody | anti-IL4 antibody

IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (PE)

Gene Names
IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL4; Monoclonal Antibody; IL4 (Interleukin-4; IL-4; B Cell Stimulatory Factor 1; BSF-1; Binetrakin; Lymphocyte Stimulatory Factor 1; Pitrakinra; MGC79402) (PE); anti-IL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D11
Specificity
Recognizes human IL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IL4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa63-153 from human IL4 (NP_000580) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL4 antibody
IL-4 is a potent lymphoid cell growth factor that stimulates the growth and survivability of certain B cells and T cells. Human IL-4 is a 15kD globular protein containing 130aa residues.
Product Categories/Family for anti-IL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.2kDa (150aa), confirmed by MALDI-TOF.
NCBI Official Full Name
interleukin-4 isoform 1
NCBI Official Synonym Full Names
interleukin 4
NCBI Official Symbol
IL4
NCBI Official Synonym Symbols
BSF1; IL-4; BCGF1; BSF-1; BCGF-1
NCBI Protein Information
interleukin-4
UniProt Protein Name
Interleukin-4
Protein Family
UniProt Gene Name
IL4
UniProt Synonym Gene Names
IL-4; BSF-1
UniProt Entry Name
IL4_HUMAN

NCBI Description

The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL4: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Belongs to the IL-4/IL-13 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Cell cycle regulation; Motility/polarity/chemotaxis; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; external side of plasma membrane

Molecular Function: protein binding; growth factor activity; cytokine activity; interleukin-4 receptor binding

Biological Process: regulation of isotype switching; negative regulation of osteoclast differentiation; positive regulation of isotype switching to IgG isotypes; positive regulation of transcription, DNA-dependent; regulation of proton transport; microglial cell activation; female pregnancy; positive regulation of activated T cell proliferation; chemotaxis; response to organic cyclic substance; positive regulation of interleukin-10 production; positive regulation of isotype switching to IgE isotypes; B cell costimulation; positive regulation of MHC class II biosynthetic process; connective tissue growth factor biosynthetic process; positive regulation of B cell proliferation; positive regulation of T cell proliferation; positive regulation of interleukin-13 production; negative regulation of macrophage activation; response to nutrient; response to drug; cholesterol metabolic process; negative regulation of chronic inflammatory response; regulation of immune response; T-helper 2 type immune response; B cell activation; regulation of phosphorylation; negative regulation of nitric oxide biosynthetic process; negative regulation of acute inflammatory response; defense response to protozoan; T-helper 1 cell lineage commitment; positive regulation of chemokine biosynthetic process; response to ethanol; innate immune response in mucosa; positive regulation of tyrosine phosphorylation of Stat5 protein; positive regulation of T cell differentiation; retina development in camera-type eye; response to cytokine stimulus; B cell differentiation; cellular defense response; positive regulation of transcription factor activity; immune response; positive regulation of transcription from RNA polymerase II promoter; T-helper 2 cell differentiation; negative regulation of transcription, DNA-dependent; positive regulation of defense response to virus by host; negative regulation of apoptosis

Disease: Stroke, Ischemic

Research Articles on IL4

Similar Products

Product Notes

The IL4 il4 (Catalog #AAA6158378) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL4 il4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.