Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human, Mouse HIST1H3D Monoclonal Antibody | anti-HIST1H3D antibody

HIST1H3D (Histone Cluster 1, Histone H3.1, H3d, H3/b, H3FB) (PE)

Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIST1H3D; Monoclonal Antibody; HIST1H3D (Histone Cluster 1; Histone H3.1; H3d; H3/b; H3FB) (PE); anti-HIST1H3D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1D8
Specificity
Recognizes human HIST1H3D. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
136
Applicable Applications for anti-HIST1H3D antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-61 from HIST1H3D (NP_003521) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml])

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in NIH/3T3)

Western Blot (WB) (HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in NIH/3T3)

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Raw 264.7)

Western Blot (WB) (HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Raw 264.7)

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Hela NE)

Western Blot (WB) (HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Hela NE)
Product Categories/Family for anti-HIST1H3D antibody
References
1. Protective Effect of Caffeic Acid on Paclitaxel Induced Anti-Proliferation and Apoptosis of Lung Cancer Cells Involves NF-?eB Pathway. Lin CL, Chen RF, Chen YF, Chu YC, Wang HM, Chou HL, Chang WC, Fong Y, Chang WT, Wu CY, Chiu CC.Int. J. Mol. Sci. 2012, 13, 6236-6245.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
histone H3.1
UniProt Protein Name
Histone H3.1
UniProt Gene Name
HIST1H3A
UniProt Synonym Gene Names
H3FA
UniProt Entry Name
H31_HUMAN

Uniprot Description

H3: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Belongs to the histone H3 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p22.2

Cellular Component: nucleoplasm; nuclear chromosome; protein complex; membrane; extracellular region; nucleosome; nucleus

Molecular Function: protein binding; DNA binding; histone binding; protein heterodimerization activity

Biological Process: chromatin silencing at rDNA; nucleosome assembly; establishment and/or maintenance of chromatin architecture; negative regulation of gene expression, epigenetic; protein heterotetramerization; gene expression; blood coagulation; regulation of gene expression, epigenetic; DNA replication-dependent nucleosome assembly; DNA methylation on cytosine

Similar Products

Product Notes

The HIST1H3D hist1h3a (Catalog #AAA6158194) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIST1H3D (Histone Cluster 1, Histone H3.1, H3d, H3/b, H3FB) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HIST1H3D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIST1H3D hist1h3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIST1H3D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.