Mouse anti-Human, Mouse HIST1H3D Monoclonal Antibody | anti-HIST1H3D antibody

HIST1H3D (Histone Cluster 1, Histone H3.1, H3d, H3/b, H3FB) (AP)

Cat. Num. AAA6131679

• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIST1H3D; Monoclonal Antibody; HIST1H3D (Histone Cluster 1; Histone H3.1; H3d; H3/b; H3FB) (AP); anti-HIST1H3D antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 1D8
• Specificity: Recognizes human HIST1H3D. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 136

• Applicable Applications for anti-HIST1H3D antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-61 from HIST1H3D (NP_003521) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml])

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in NIH/3T3)

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Raw 264.7)

Western Blot (WB)

(HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Hela NE)

Product Categories/Family for anti-HIST1H3D antibody

Antibodies; Histones

References

1. Protective Effect of Caffeic Acid on Paclitaxel Induced Anti-Proliferation and Apoptosis of Lung Cancer Cells Involves NF-?eB Pathway. Lin CL, Chen RF, Chen YF, Chu YC, Wang HM, Chou HL, Chang WC, Fong Y, Chang WT, Wu CY, Chiu CC.Int. J. Mol. Sci. 2012, 13, 6236-6245.

NCBI and Uniprot Product Information

• NCBI GI #: 21071021
• NCBI Accession #: NP_003521
• NCBI GenBank Nucleotide #: NM_003530
• UniProt Accession #: P68431
• NCBI Official Full Name: histone H3.1
• UniProt Protein Name: Histone H3.1
• UniProt Gene Name: HIST1H3A
• UniProt Synonym Gene Names: H3FA
• UniProt Entry Name: H31_HUMAN

Uniprot Description

H3: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Belongs to the histone H3 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p22.2

Cellular Component: nucleoplasm; nuclear chromosome; protein complex; membrane; extracellular region; nucleosome; nucleus

Molecular Function: protein binding; DNA binding; histone binding; protein heterodimerization activity

Biological Process: chromatin silencing at rDNA; nucleosome assembly; establishment and/or maintenance of chromatin architecture; negative regulation of gene expression, epigenetic; protein heterotetramerization; gene expression; blood coagulation; regulation of gene expression, epigenetic; DNA replication-dependent nucleosome assembly; DNA methylation on cytosine