Mouse anti-Human F9 Monoclonal Antibody | anti-F9 antibody

F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) (PE)

Cat. Num. AAA6157726

• Gene Names: F9; FIX; P19; PTC; HEMB; THPH8
• Reactivity: Human
• Applications: Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: F9; Monoclonal Antibody; F9 (Coagulation Factor IX; Christmas Factor; Plasma Thromboplastin Component; PTC) (PE); anti-F9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C9
• Specificity: Recognizes human F9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-F9 antibody: FLISA, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa96-190 from human F9 (NP_000124) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of F9 expression in transfected 293T cell line by MBS6011342 Lane 1: F9 transfected lysate (51.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of F9 transfected lysate using MBS6011342 and Protein A Magnetic Bead and immunoblotted with F9 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged F9 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS6011342. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-F9 antibody

Coagulation Factor IX (F9) circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease.

Product Categories/Family for anti-F9 antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4503649
• NCBI GeneID: 2158
• NCBI Accession #: NP_000124
• NCBI GenBank Nucleotide #: NM_000133
• UniProt Accession #: P00740; Q5FBE1; Q5JYJ8; A8K9N4; F2RM36
• Molecular Weight: 47,618 Da
• NCBI Official Full Name: coagulation factor IX preproprotein
• NCBI Official Synonym Full Names: coagulation factor IX
• NCBI Official Symbol: F9
• NCBI Official Synonym Symbols: FIX; P19; PTC; HEMB; THPH8
• NCBI Protein Information: coagulation factor IX; Christmas factor; F9 p22; FIX F9; factor 9; factor IX F9; plasma thromboplastic component; plasma thromboplastin component
• UniProt Protein Name: Coagulation factor IX
• Protein Family: F9 protein
• UniProt Gene Name: F9
• UniProt Synonym Gene Names: PTC
• UniProt Entry Name: FA9_HUMAN

Uniprot Description

F9: Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca(2+) ions, phospholipids, and factor VIIIa. Defects in F9 are the cause of recessive X-linked hemophilia B (HEMB); also known as Christmas disease. Mutations in position 43 (Oxford-3, San Dimas) and 46 (Cambridge) prevents cleavage of the propeptide, mutation in position 93 (Alabama) probably fails to bind to cell membranes, mutation in position 191 (Chapel-Hill) or in position 226 (Nagoya OR Hilo) prevent cleavage of the activation peptide. Defects in F9 are the cause of thrombophilia due to factor IX defect (THPH8). A hemostatic disorder characterized by a tendency to thrombosis. Belongs to the peptidase S1 family.

Protein type: Secreted; Protease; Secreted, signal peptide; EC 3.4.21.22

Chromosomal Location of Human Ortholog: Xq27.1-q27.2

Cellular Component: Golgi lumen; endoplasmic reticulum lumen; plasma membrane; extracellular region

Molecular Function: serine-type endopeptidase activity; calcium ion binding

Biological Process: blood coagulation, extrinsic pathway; cellular protein metabolic process; post-translational protein modification; blood coagulation; proteolysis; peptidyl-glutamic acid carboxylation; blood coagulation, intrinsic pathway

Disease: Hemophilia B; Thrombophilia, X-linked, Due To Factor Ix Defect; Coumarin Resistance