Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human ELF5 Monoclonal Antibody | anti-ELF5 antibody

ELF5 (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (PE)

Gene Names
ELF5; ESE2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELF5; Monoclonal Antibody; ELF5 (ETS-related Transcription Factor Elf-5; E74-like Factor 5; Epithelium-specific Ets Transcription Factor 2; ESE-2; Epithelium-restricted ESE-1-related Ets Factor; ESE2) (PE); anti-ELF5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes human ELF5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ELF5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa166-263 from human ELF5 (NP_938195.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of ELF5 expression in transfected 293T cell line by ELF5 monoclonal antibody. Lane 1: ELF5 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ELF5 expression in transfected 293T cell line by ELF5 monoclonal antibody. Lane 1: ELF5 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ELF5 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELF5 is 3ng/ml as a capture antibody.)
Related Product Information for anti-ELF5 antibody
ELF5 is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus.
Product Categories/Family for anti-ELF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,866 Da
NCBI Official Full Name
ETS-related transcription factor Elf-5 isoform 1
NCBI Official Synonym Full Names
E74 like ETS transcription factor 5
NCBI Official Symbol
ELF5
NCBI Official Synonym Symbols
ESE2
NCBI Protein Information
ETS-related transcription factor Elf-5

NCBI Description

The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011]

Research Articles on ELF5

Similar Products

Product Notes

The ELF5 (Catalog #AAA6157622) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELF5 (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELF5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELF5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELF5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.