Mouse anti-Human CREB3L4 Monoclonal Antibody | anti-CREB3L4 antibody

CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP, Attaching to CRE-like 1, ATCE1, Cyclic AMP-responsive Element

Cat. Num. AAA6157258

• Gene Names: CREB3L4; JAL; hJAL; ATCE1; CREB3; CREB4; AIBZIP
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CREB3L4; Monoclonal Antibody; CREB3L4 (AIBZIP; Cyclic AMP-responsive Element-binding Protein 3-like Protein 4; cAMP-responsive Element-binding Protein 3-like Protein 4; Androgen-induced Basic Leucine Zipper Protein; AIbZIP; Attaching to CRE-like 1; ATCE1; Cyclic AMP-responsive Element; anti-CREB3L4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E3
• Specificity: Recognizes human CREB3L4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 395

• Applicable Applications for anti-CREB3L4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa1-111 from human CREB3L4 (NP_570968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(Western Blot analysis of CREB3L4 expression in transfected 293T cell line by CREB3L4 monoclonal antibody. Lane 1: CREB3L4 transfected lysate (43.4kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CREB3L4 on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western blot analysis of CREB3L4 over-expressed 293 cell line, cotransfected with CREB3L4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3L4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CREB3 and CREB3L4 HeLa cells were stained with CREB3 rabbit purified polyclonal 1:1200 and CREB3L4 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-CREB3L4 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18702325
• NCBI GeneID: 148327
• NCBI Accession #: NP_570968
• NCBI GenBank Nucleotide #: NM_130898
• UniProt Accession #: Q8TEY5
• NCBI Official Full Name: cyclic AMP-responsive element-binding protein 3-like protein 4 isoform 1
• NCBI Official Synonym Full Names: cAMP responsive element binding protein 3 like 4
• NCBI Official Symbol: CREB3L4
• NCBI Official Synonym Symbols: JAL; hJAL; ATCE1; CREB3; CREB4; AIBZIP
• NCBI Protein Information: cyclic AMP-responsive element-binding protein 3-like protein 4
• UniProt Protein Name: Cyclic AMP-responsive element-binding protein 3-like protein 4
• Protein Family: Cyclic AMP-responsive element-binding protein 3-like protein
• UniProt Gene Name: CREB3L4
• UniProt Synonym Gene Names: AIBZIP; CREB4; JAL; cAMP-responsive element-binding protein 3-like protein 4; AIbZIP; ATCE1; CREB-4; cAMP-responsive element-binding protein 4; Tisp40
• UniProt Entry Name: CR3L4_HUMAN

NCBI Description

This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in a number of processing pathways including protein processing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

CREB3L4: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional activation activity from UPRE. Binds to NF-kappa-B site and has transcriptional activation activity from NF-kappa-B-containing regulatory elements. Belongs to the bZIP family. ATF subfamily.

Protein type: Transcription factor; Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; nucleus

Biological Process: transcription, DNA-dependent; unfolded protein response; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis