Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (74.95kD).)

Mouse anti-Human ANGPTL3 Monoclonal Antibody | anti-ANGPTL3 antibody

ANGPTL3 (Angiopoietin-related Protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like Protein 3, ANGPT5, FHBL2, UNQ153/PRO179) (PE)

Gene Names
ANGPTL3; ANL3; ANG-5; FHBL2; ANGPT5
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANGPTL3; Monoclonal Antibody; ANGPTL3 (Angiopoietin-related Protein 3; Angiopoietin-5; ANG-5; Angiopoietin-like Protein 3; ANGPT5; FHBL2; UNQ153/PRO179) (PE); anti-ANGPTL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B7
Specificity
Recognizes human ANGPTL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ANGPTL3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa17-461 from human ANGPTL3 (AAH58287) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (74.95kD).)

Western Blot (WB) (Western Blot detection against Immunogen (74.95kD).)

Western Blot (WB)

(Western Blot analysis of ANGPTL3 expression in transfected 293T cell line by ANGPTL3 monoclonal antibody. Lane 1: ANGPTL3 transfected lysate (Predicted MW: 53.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ANGPTL3 expression in transfected 293T cell line by ANGPTL3 monoclonal antibody. Lane 1: ANGPTL3 transfected lysate (Predicted MW: 53.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANGPTL3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ANGPTL3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ANGPTL3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ANGPTL3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-ANGPTL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
53,637 Da
NCBI Official Full Name
Homo sapiens angiopoietin-like 3, mRNA
NCBI Official Synonym Full Names
angiopoietin-like 3
NCBI Official Symbol
ANGPTL3
NCBI Official Synonym Symbols
ANL3; ANG-5; FHBL2; ANGPT5
NCBI Protein Information
angiopoietin-related protein 3; angiopoietin 5

NCBI Description

This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metablism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Feb 2013]

Research Articles on ANGPTL3

Similar Products

Product Notes

The ANGPTL3 (Catalog #AAA6156507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANGPTL3 (Angiopoietin-related Protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like Protein 3, ANGPT5, FHBL2, UNQ153/PRO179) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPTL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANGPTL3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPTL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.