Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (64.13kD).)

Mouse anti-Human AHSG Monoclonal Antibody | anti-AHSG antibody

AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (PE)

Gene Names
AHSG; AHS; A2HS; HSGA; APMR1; FETUA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AHSG; Monoclonal Antibody; AHSG (Alpha-2-HS-Glycoprotein; Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; Fetuin-A; FETUA; PRO2743) (PE); anti-AHSG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D8
Specificity
Recognizes human AHSG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1575
Applicable Applications for anti-AHSG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa19-367 from human AHSG (AAH48198) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (64.13kD).)

Western Blot (WB) (Western Blot detection against Immunogen (64.13kD).)

Testing Data

(Detection limit for recombinant GST tagged AHSG is ~0.1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged AHSG is ~0.1ng/ml as a capture antibody)
Related Product Information for anti-AHSG antibody
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.
Product Categories/Family for anti-AHSG antibody
References
1. A proteomics approach to identify changes in protein profiles in serum of Familial Adenomatous Polyposis patients. Quaresima B, Crugliano T, Gaspari M, Faniello MC, Cosimo P, Valanzano R, Genuardi M, Cannataro M, Veltri P, Baudi F, Doldo P, Cuda G, Venuta S, Costanzo F.Cancer Lett. 2008 Dec 8; 272(1):40-52. Epub 2008 Jul 29.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
197
NCBI Official Full Name
Homo sapiens alpha-2-HS-glycoprotein, mRNA
NCBI Official Synonym Full Names
alpha 2-HS glycoprotein
NCBI Official Symbol
AHSG
NCBI Official Synonym Symbols
AHS; A2HS; HSGA; APMR1; FETUA
NCBI Protein Information
alpha-2-HS-glycoprotein
Protein Family

NCBI Description

The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017]

Research Articles on AHSG

Similar Products

Product Notes

The AHSG (Catalog #AAA6156436) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AHSG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AHSG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AHSG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.