Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human AFF4 Monoclonal Antibody | anti-AFF4 antibody

AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) (PE)

Gene Names
AFF4; MCEF; CHOPS; AF5Q31
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AFF4; Monoclonal Antibody; AFF4 (AF5q31; AF5Q31; MCEF; AF4/FMR2 Family Member 4; ALL1-fused Gene from Chromosome 5q31 Protein; Major CDK9 Elongation Factor-associated Protein) (PE); anti-AFF4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E12
Specificity
Recognizes human AFF4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1163
Applicable Applications for anti-AFF4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-109 from human AFF4 (NP_055238) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of AFF4 expression in transfected 293T cell line by AFF4 monoclonal antibody. Lane 1: AFF4 transfected lysate (40.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AFF4 expression in transfected 293T cell line by AFF4 monoclonal antibody. Lane 1: AFF4 transfected lysate (40.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AFF4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to AFF4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AFF4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AFF4 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-AFF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
AF4/FMR2 family member 4
NCBI Official Synonym Full Names
AF4/FMR2 family member 4
NCBI Official Symbol
AFF4
NCBI Official Synonym Symbols
MCEF; CHOPS; AF5Q31
NCBI Protein Information
AF4/FMR2 family member 4
UniProt Protein Name
AF4/FMR2 family member 4
Protein Family
UniProt Gene Name
AFF4
UniProt Synonym Gene Names
AF5Q31; MCEF; Protein AF-5q31
UniProt Entry Name
AFF4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). [provided by RefSeq, Oct 2011]

Uniprot Description

MCEF: a putative transcription factor. Component of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor b (P-TEFb). Genetic fusion of its gene with MLL has been observed in a subset of acute lymphoblastic leukemia patients. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; transcription elongation factor complex; mitochondrion; nucleolus; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; spermatid development

Disease: Chops Syndrome

Research Articles on AFF4

Similar Products

Product Notes

The AFF4 aff4 (Catalog #AAA6156423) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AFF4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AFF4 aff4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AFF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.