Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RHOQ Monoclonal Antibody | anti-RHOQ antibody

RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (HRP)

Gene Names
RHOQ; ARHQ; TC10; TC10A; RASL7A; HEL-S-42
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOQ; Monoclonal Antibody; RHOQ (TC10; ARHQ; RASL7A; Rho-related GTP-binding Protein RhoQ; Ras-like Protein TC10; Ras-like Protein Family Member 7A) (HRP); anti-RHOQ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C1
Specificity
Recognizes human RHOQ.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
4780
Applicable Applications for anti-RHOQ antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa106-205 from RHOQ (NP_036381) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLI*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-RHOQ antibody
TC10 is a member of the Rho family of GTP-binding proteins and is closely related to Cdc42 and Rac 1. Cycling between inactive and active GTP-bound state, active TC10 can directly interact with Cdc42 kinase, p21-activated protein kinases as well as other kinases. Constitutive expression of active TC10 mutants (TC10/Q75L) in fibroblast decrease actin stress fiber and formation of plasma membrane microspikes, while wild type TC10 has no effect on fibroblast cell morphology. Mostly expressed in adipose and muscle tissues, TC10 has been found to be activated by C3G (from the insulin pathway) in adipocytes.
Product Categories/Family for anti-RHOQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ras homolog family member Q (RHOQ), mRNA
NCBI Official Synonym Full Names
ras homolog family member Q
NCBI Official Symbol
RHOQ
NCBI Official Synonym Symbols
ARHQ; TC10; TC10A; RASL7A; HEL-S-42
NCBI Protein Information
rho-related GTP-binding protein RhoQ
UniProt Protein Name
Rho-related GTP-binding protein RhoQ
UniProt Gene Name
RHOQ
UniProt Synonym Gene Names
ARHQ; RASL7A; TC10
UniProt Entry Name
RHOQ_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein is an important signalling protein for sarcomere assembly and has been shown to play a significant role in the exocytosis of the solute carrier family 2, facilitated glucose transporter member 4 and other proteins, possibly acting as the signal that turns on the membrane fusion machinery. Three related pseudogene have been identified on chromosomes 2 and 14. [provided by RefSeq, Aug 2011]

Uniprot Description

RHOQ: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. May play a role in CFTR trafficking to the plasma membrane. Causes the formation of thin, actin-rich surface projections called filopodia. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; G protein; G protein, monomeric, Rho; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: plasma membrane; actin filament; cytosol; lipid raft

Molecular Function: GTPase activity; GTP binding; GBD domain binding; profilin binding

Biological Process: positive regulation of filopodium formation; regulation of cell shape; positive regulation of glucose import; regulation of small GTPase mediated signal transduction; cellular response to insulin stimulus; metabolic process; regulation of actin cytoskeleton organization and biogenesis; small GTPase mediated signal transduction; insulin receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; cortical actin cytoskeleton organization and biogenesis

Research Articles on RHOQ

Similar Products

Product Notes

The RHOQ rhoq (Catalog #AAA6154636) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOQ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOQ rhoq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOQ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.