Mouse anti-Human POU6F2 Monoclonal Antibody | anti-POU6F2 antibody

POU6F2 (RPF1, POU Domain, Class 6, Transcription Factor 2, Retina-derived POU Domain Factor 1) (HRP)

Cat. Num. AAA6154286

• Gene Names: POU6F2; WT5; WTSL; RPF-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POU6F2; Monoclonal Antibody; POU6F2 (RPF1; POU Domain; Class 6; Transcription Factor 2; Retina-derived POU Domain Factor 1) (HRP); anti-POU6F2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8F9
• Specificity: Recognizes human POU6F2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-POU6F2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-88 from POU6F2 (NP_009183) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.57kD).)

Related Product Information for anti-POU6F2 antibody

This gene encodes a member of the POU protein family characterized by the presence of a bipartite DNA binding domain, consisting of a POU-specific domain and a homeodomain, separated by a variable polylinker. The DNA binding domain may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner. The POU family members are transcriptional regulators, many of which are known to control cell type-specific differentiation pathways. This gene is a tumor suppressor involved in Wilms tumor (WT) predisposition. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Product Categories/Family for anti-POU6F2 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 157743257
• NCBI GeneID: 11281
• NCBI Accession #: NP_009183
• NCBI GenBank Nucleotide #: NM_007252
• UniProt Accession #: P78424
• Molecular Weight: 73kDa
• NCBI Official Full Name: POU domain, class 6, transcription factor 2 isoform 1
• NCBI Official Synonym Full Names: POU class 6 homeobox 2
• NCBI Official Symbol: POU6F2
• NCBI Official Synonym Symbols: WT5; WTSL; RPF-1
• NCBI Protein Information: POU domain, class 6, transcription factor 2
• UniProt Protein Name: POU domain, class 6, transcription factor 2
• Protein Family: POU domain, class 6, transcription factor
• UniProt Gene Name: POU6F2
• UniProt Synonym Gene Names: RPF1; RPF-1
• UniProt Entry Name: PO6F2_HUMAN

NCBI Description

This gene encodes a member of the POU protein family characterized by the presence of a bipartite DNA binding domain, consisting of a POU-specific domain and a homeodomain, separated by a variable polylinker. The DNA binding domain may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner. The POU family members are transcriptional regulators, many of which are known to control cell type-specific differentiation pathways. This gene is a tumor suppressor involved in Wilms tumor (WT) predisposition. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

Function: Probable transcription factor likely to be involved in early steps in the differentiation of amacrine and ganglion cells. Recognizes and binds to the DNA sequence 5'-ATGCAAAT-3'. Isoform 1 does not bind DNA.

Subcellular location: Nucleus

Probable.

Tissue specificity: Expressed only within the CNS, where its expression is restricted to the medical habenulla, to a dispersed population of neurons in the dorsal hypothalamus, and to subsets of ganglion and amacrine cells in the retina. Ref.1

Involvement in disease: Hereditary susceptibility to Wilms tumor 5 (WT5) [MIM:601583]: Pediatric malignancy of kidney and one of the most common solid cancers in childhood.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.4

Sequence similarities: Belongs to the POU transcription factor family. Class-6 subfamily.Contains 1 homeobox DNA-binding domain.Contains 1 POU-specific domain.

Sequence caution: The sequence AAB49727.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAB49728.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAS07475.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence EAL23992.1 differs from that shown. Reason: Erroneous gene model prediction.