Mouse P15RS Monoclonal Antibody | anti-P15RS antibody

P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (HRP)

Cat. Num. AAA6153942

• Gene Names: RPRD1A; P15RS; HsT3101
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: P15RS; Monoclonal Antibody; P15RS (RPRD1A; Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A; Cyclin-dependent Kinase Inhibitor 2B-related Protein; p15INK4B-related Protein; FLJ10656; HsT3101; MGC19513) (HRP); anti-P15RS antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B8
• Specificity: Recognizes human P15RS. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-P15RS antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa76-171 from human P15RS (NP_060640) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(P15RS monoclonal antibody. Western Blot analysis of P15RS expression in PC-12.)

Western Blot (WB)

(P15RS monoclonal antibody, Western Blot analysis of P15RS expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to P15RS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged P15RS is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(P15RS monoclonal antibody. Western Blot analysis of P15RS expression in NIH/3T3.)

Product Categories/Family for anti-P15RS antibody

Antibodies; Protein Kinase Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 21361709
• NCBI GeneID: 55197
• NCBI Accession #: NP_060640
• NCBI GenBank Nucleotide #: NM_018170
• UniProt Accession #: Q96P16; Q7Z5G8; Q96FY9; Q9NVL4; A8KA42; B2RBA3
• Molecular Weight: 38.4kDa (337aa) confirmed by MALDI-TOF
• NCBI Official Full Name: regulation of nuclear pre-mRNA domain-containing protein 1A isoform 1
• NCBI Official Synonym Full Names: regulation of nuclear pre-mRNA domain containing 1A
• NCBI Official Symbol: RPRD1A
• NCBI Official Synonym Symbols: P15RS; HsT3101
• NCBI Protein Information: regulation of nuclear pre-mRNA domain-containing protein 1A
• UniProt Protein Name: Regulation of nuclear pre-mRNA domain-containing protein 1A
• UniProt Gene Name: RPRD1A
• UniProt Synonym Gene Names: P15RS

NCBI Description

This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014]

Uniprot Description

Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.