<
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse NEK9 Monoclonal Antibody | anti-NEK9 antibody
NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (HRP)
Gene Names
NEK9; NC; APUG; NERCC; LCCS10; NERCC1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEK9; Monoclonal Antibody; NEK9 (Serine/Threonine-protein Kinase Nek9; Nercc1 Kinase; Never in Mitosis A-related Kinase 9; NimA-related Protein Kinase 9; NimA-related Kinase 8; Nek8; KIAA1995; NEK8; NERCC; DKFZp434D0935; MGC138306; MGC16714; NERCC1) (HRP); anti-NEK9 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F6
Specificity
Recognizes human NEK9. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3443
Applicable Applications for anti-NEK9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa226-326 from human NEK9 (AAH09336) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(NEK9 monoclonal antibody. Western Blot analysis of NEK9 expression in NIH/3T3.)
Western Blot (WB)
(NEK9 monoclonal antibody. Western Blot analysis of NEK9 expression in NIH/3T3.)
Western Blot (WB)
(Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody. Lane 1: NEK9 transfected lysate (107.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody. Lane 1: NEK9 transfected lysate (107.2kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged NEK9 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NEK9 is ~0.03ng/ml as a capture antibody.)
Western Blot (WB)
(NEK9 monoclonal antibody Western Blot analysis of NEK9 expression in HeLa.)
Western Blot (WB)
(NEK9 monoclonal antibody Western Blot analysis of NEK9 expression in HeLa.)
Western Blot (WB)
(NEK9 monoclonal antibody. Western Blot analysis of NEK9 expression in PC-12.)
Western Blot (WB)
(NEK9 monoclonal antibody. Western Blot analysis of NEK9 expression in PC-12.)
Related Product Information for anti-NEK9 antibody
Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues Important for G1/S transition and S phase progression (By similarity).
Product Categories/Family for anti-NEK9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens NIMA (never in mitosis gene a)- related kinase 9, mRNA
NCBI Official Synonym Full Names
NIMA related kinase 9
NCBI Official Symbol
NEK9
NCBI Official Synonym Symbols
NC; APUG; NERCC; LCCS10; NERCC1
NCBI Protein Information
serine/threonine-protein kinase Nek9
Protein Family
NCBI Description
This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein is activated in mitosis and, in turn, activates other family members during mitosis. This protein also mediates cellular processes that are essential for interphase progression. [provided by RefSeq, Jul 2016]
Research Articles on NEK9
Similar Products
Product Notes
The NEK9 (Catalog #AAA6153754) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEK9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEK9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEK9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
