Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human LOXL4 Monoclonal Antibody | anti-LOXL4 antibody
LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP)
Gene Names
LOXL4; LOXC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LOXL4; Monoclonal Antibody; LOXL4 (Lysyl Oxidase Homolog 4; Lysyl Oxidase-like Protein 4; Lysyl Oxidase-related Protein C; LOXC) (HRP); anti-LOXL4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4H7
Specificity
Recognizes human LOXL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-LOXL4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa657-756 from human LOXL4 (NP_115587) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-LOXL4 antibody
May modulate the formation of a collagenous extracellular matrix.
Product Categories/Family for anti-LOXL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
lysyl oxidase homolog 4
NCBI Official Synonym Full Names
lysyl oxidase like 4
NCBI Official Symbol
LOXL4
NCBI Official Synonym Symbols
LOXC
NCBI Protein Information
lysyl oxidase homolog 4
UniProt Protein Name
Lysyl oxidase homolog 4
Protein Family
UniProt Gene Name
LOXL4
UniProt Synonym Gene Names
LOXC
NCBI Description
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq, Jul 2008]
Uniprot Description
May modulate the formation of a collagenous extracellular matrix.
Research Articles on LOXL4
Similar Products
Product Notes
The LOXL4 loxl4 (Catalog #AAA6153348) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LOXL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LOXL4 loxl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOXL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
