Mouse anti-Human CRSP3 Monoclonal Antibody | anti-CRSP3 antibody

CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog

Cat. Num. AAA6151968

• Gene Names: MED23; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP130; CRSP133; DRIP130
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRSP3; Monoclonal Antibody; CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23; Activator-recruited Cofactor 130kD Component; ARC130; Cofactor Required for Sp1 Transcriptional Activation Subunit 3; CRSP Complex Subunit 3; Mediator Complex Subunit 23; Protein Sur-2 Homolog; anti-CRSP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes human CRSP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CRSP3 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa531-630 from CRSP3 (NP_004821) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MED23 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-CRSP3 antibody

Required for transcriptional activation subsequent to the assembly of the preinitiation complex By similarity. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling.

Product Categories/Family for anti-CRSP3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 28558971
• NCBI GeneID: 9439
• NCBI Accession #: NP_004821
• NCBI GenBank Nucleotide #: NM_004830
• UniProt Accession #: Q9ULK4
• Molecular Weight: 156kDa
• NCBI Official Full Name: mediator of RNA polymerase II transcription subunit 23 isoform a
• NCBI Official Synonym Full Names: mediator complex subunit 23
• NCBI Official Symbol: MED23
• NCBI Official Synonym Symbols: SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP130; CRSP133; DRIP130
• NCBI Protein Information: mediator of RNA polymerase II transcription subunit 23
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 23
• Protein Family: Calcitonin receptor-stimulating peptide
• UniProt Gene Name: MED23
• UniProt Synonym Gene Names: ARC130; CRSP3; DRIP130; KIAA1216; SUR2; ARC130; CRSP complex subunit 3; hSur-2; DRIP130
• UniProt Entry Name: MED23_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

MED23: Required for transcriptional activation subsequent to the assembly of the preinitiation complex. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling. Defects in MED23 are the cause of mental retardation autosomal recessive type 18 (MRT18). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the Mediator complex subunit 23 family. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6q22.33-q24.1

Cellular Component: nucleoplasm; transcription factor complex; Srb-mediator complex

Molecular Function: protein binding; transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; gene expression

Disease: Mental Retardation, Autosomal Recessive 18