Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CHRNA4 Monoclonal Antibody | anti-CHRNA4 antibody

CHRNA4 (Neuronal Acetylcholine Receptor Subunit alpha-4, NACRA4) (HRP)

Gene Names
CHRNA4; EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHRNA4; Monoclonal Antibody; CHRNA4 (Neuronal Acetylcholine Receptor Subunit alpha-4; NACRA4) (HRP); anti-CHRNA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E3
Specificity
Recognizes human CHRNA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CHRNA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-129 from human CHRNA4 (NP_000735) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-CHRNA4 antibody
This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.
Product Categories/Family for anti-CHRNA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,994 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-4 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor, nicotinic, alpha 4 (neuronal)
NCBI Official Symbol
CHRNA4
NCBI Official Synonym Symbols
EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-4; cholinergic receptor, nicotinic, alpha polypeptide 4; neuronal nicotinic acetylcholine receptor alpha-4 subunit
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-4
UniProt Gene Name
CHRNA4
UniProt Synonym Gene Names
NACRA4
UniProt Entry Name
ACHA4_HUMAN

Uniprot Description

nAChRA4: a ligand-gated ion channels that binds acetylcholine and mediates fast signal transmission at synapses. After binding acetylcholine, these pentameric receptors undergo an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. An integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, ligand-gated; Receptor, misc.

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; cell soma; membrane; dendrite; integral to membrane; plasma membrane; cell junction; external side of plasma membrane

Molecular Function: acetylcholine receptor activity; acetylcholine binding; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: response to nicotine; regulation of action potential; B cell activation; behavioral response to nicotine; locomotory behavior; respiratory gaseous exchange; signal transduction; DNA repair; sensory perception of pain; regulation of dopamine secretion; synaptic transmission, cholinergic; neurological system process; regulation of inhibitory postsynaptic membrane potential; synaptic transmission; membrane depolarization; regulation of membrane potential; calcium ion transport; response to hypoxia; ion transport; response to oxidative stress; cognition

Disease: Epilepsy, Nocturnal Frontal Lobe, 1; Tobacco Addiction, Susceptibility To

Similar Products

Product Notes

The CHRNA4 chrna4 (Catalog #AAA6151798) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHRNA4 (Neuronal Acetylcholine Receptor Subunit alpha-4, NACRA4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHRNA4 chrna4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRNA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.