Mouse anti-Human APOB48R Monoclonal Antibody | anti-APOB48R antibody

APOB48R (Apolipoprotein B Receptor, Apolipoprotein B-100 Receptor, Apolipoprotein B-48 Receptor, Apolipoprotein B48 Receptor, apoB-48R, APOBR) (HRP)

Cat. Num. AAA6151237

• Gene Names: APOBR; APOB48R; APOB100R
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APOB48R; Monoclonal Antibody; APOB48R (Apolipoprotein B Receptor; Apolipoprotein B-100 Receptor; Apolipoprotein B-48 Receptor; Apolipoprotein B48 Receptor; apoB-48R; APOBR) (HRP); anti-APOB48R antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D7
• Specificity: Recognizes human APOB48R.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-APOB48R antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa71-170 from human APOB48R with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD) usingMBS6011388.)

Immunohistochemistry (IHC)

(Immunoperoxidase of MBS6011388 (1.5ug/ml) on formalin-fixed paraffin-embedded human prostate.)

Product Categories/Family for anti-APOB48R antibody

Antibodies; Lipoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 340138932
• NCBI GeneID: 55911
• NCBI Accession #: NP_061160
• NCBI GenBank Nucleotide #: NM_018690
• UniProt Accession #: Q0VD83; Q0VD81; Q8NC15; Q9NPJ9; H3BU97
• Molecular Weight: 114,874 Da
• NCBI Official Full Name: apolipoprotein B receptor
• NCBI Official Synonym Full Names: apolipoprotein B receptor
• NCBI Official Symbol: APOBR
• NCBI Official Synonym Symbols: APOB48R; APOB100R
• NCBI Protein Information: apolipoprotein B receptor; apoB-48R; apolipoprotein B48 receptor; apolipoprotein B-48 receptor; apolipoprotein B100 receptor; apolipoprotein B-100 receptor
• UniProt Protein Name: Apolipoprotein B receptor
• UniProt Gene Name: APOBR
• UniProt Synonym Gene Names: APOB48R; Apolipoprotein B48 receptor; apoB-48R
• UniProt Entry Name: APOBR_HUMAN

NCBI Description

Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

APOB48R: Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG- VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.

Chromosomal Location of Human Ortholog: 16p11

Cellular Component: chylomicron; membrane; plasma membrane

Molecular Function: very-low-density lipoprotein receptor activity

Biological Process: receptor-mediated endocytosis; cholesterol metabolic process; triacylglycerol metabolic process; lipid transport