Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ABCG2 Monoclonal Antibody | anti-ABCG2 antibody

ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (HRP)

Gene Names
ABCG2; MRX; MXR; ABCP; BCRP; BMDP; MXR1; ABC15; BCRP1; CD338; GOUT1; MXR-1; CDw338; UAQTL1; EST157481
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABCG2; Monoclonal Antibody; ABCG2 (ATP-binding Cassette Sub-family G Member 2; Placenta-specific ATP-binding Cassette Transporter; Breast Cancer Resistance Protein; Mitoxantrone Resistance-associated Protein; CD338 Antigen; CDw338; ABCP; BCRP; BCRP1; MXR) (HRP); anti-ABCG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G1
Specificity
Recognizes human ABCG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ABCG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa156-265 from ABCG2 (NP_004818) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGRLM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)
Related Product Information for anti-ABCG2 antibody
ABCG2 is a membrane-associated protein included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Product Categories/Family for anti-ABCG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
ATP-binding cassette sub-family G member 2 isoform 1
NCBI Official Synonym Full Names
ATP binding cassette subfamily G member 2 (Junior blood group)
NCBI Official Symbol
ABCG2
NCBI Official Synonym Symbols
MRX; MXR; ABCP; BCRP; BMDP; MXR1; ABC15; BCRP1; CD338; GOUT1; MXR-1; CDw338; UAQTL1; EST157481
NCBI Protein Information
ATP-binding cassette sub-family G member 2
UniProt Protein Name
ATP-binding cassette sub-family G member 2
Protein Family
UniProt Gene Name
ABCG2
UniProt Synonym Gene Names
ABCP; BCRP; BCRP1; MXR
UniProt Entry Name
ABCG2_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

ABCG2: Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. When overexpressed, the transfected cells become resistant to mitoxantrone, daunorubicin and doxorubicin, display diminished intracellular accumulation of daunorubicin, and manifest an ATP- dependent increase in the efflux of rhodamine 123. Monomer or homodimer; disulfide-linked. Up-regulated in brain tumors. Highly expressed in placenta. Low expression in small intestine, liver and colon. Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, iron; Membrane protein, multi-pass; Membrane protein, integral; Transporter, ABC family

Chromosomal Location of Human Ortholog: 4q22

Cellular Component: nucleoplasm; mitochondrial membrane; integral to membrane; plasma membrane; nucleus

Molecular Function: protein binding; protein homodimerization activity; ATPase activity, coupled to transmembrane movement of substances; transporter activity; heme transporter activity; xenobiotic-transporting ATPase activity; ATP binding

Biological Process: response to drug; heme transport; urate metabolic process; transport; cellular iron ion homeostasis; xenobiotic transport; multidrug transport; transmembrane transport

Disease: Blood Group, Junior System; Uric Acid Concentration, Serum, Quantitative Trait Locus 1

Research Articles on ABCG2

Similar Products

Product Notes

The ABCG2 abcg2 (Catalog #AAA6151030) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCG2 abcg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.