Mouse anti-Human VAV1 Monoclonal Antibody | anti-VAV1 antibody

VAV1 (Proto-oncogene Vav, VAV) (FITC)

Cat. Num. AAA6150428

• Gene Names: VAV1; VAV
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VAV1; Monoclonal Antibody; VAV1 (Proto-oncogene Vav; VAV) (FITC); anti-VAV1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A11
• Specificity: Recognizes human VAV1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-VAV1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa681-790 from human VAV1 (AAH13361) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VAV1 monoclonal antibody, Western Blot analysis of VAV1 expression in Jurkat.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VAV1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged VAV1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-VAV1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33991319
• NCBI GeneID: 7409
• Molecular Weight: 94,493 Da
• NCBI Official Full Name: Homo sapiens vav 1 guanine nucleotide exchange factor, mRNA
• NCBI Official Synonym Full Names: vav guanine nucleotide exchange factor 1
• NCBI Official Symbol: VAV1
• NCBI Official Synonym Symbols: VAV
• NCBI Protein Information: proto-oncogene vav
• Protein Family: Proto-oncogene

NCBI Description

This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. The encoded protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. The encoded protein has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]