Mouse anti-Human TWIST1 Monoclonal Antibody | anti-TWIST1 antibody

TWIST1 (Twist-related Protein 1, H-twist, TWIST Class A Basic helix-loop-helix Protein 38, bHLHa38) (FITC)

Cat. Num. AAA6150298

• Gene Names: TWIST1; CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; SWCOS; TWIST; bHLHa38
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TWIST1; Monoclonal Antibody; TWIST1 (Twist-related Protein 1; H-twist; TWIST Class A Basic helix-loop-helix Protein 38; bHLHa38) (FITC); ACS3; BPES2; BPES3; CRS1; SCS; anti-TWIST1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E11
• Specificity: Recognizes human TWIST1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TWIST1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa100-202 from human TWIST1 (NP_000465) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody. Lane 1: TWIST1 transfected lysate (21kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of TWIST1 transfected lysate using TWIST1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TWIST1 rabbit polyclonal antibody.)

Western Blot (WB)

(Western blot analysis of TWIST1 over-expressed 293 cell line, cotransfected with TWIST1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TWIST1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-TWIST1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4507741
• NCBI GeneID: 7291
• NCBI Accession #: NP_000465
• NCBI GenBank Nucleotide #: NM_000474
• UniProt Accession #: Q15672
• Molecular Weight: 22kDa
• NCBI Official Full Name: twist-related protein 1
• NCBI Official Synonym Full Names: twist family bHLH transcription factor 1
• NCBI Official Symbol: TWIST1
• NCBI Official Synonym Symbols: CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; SWCOS; TWIST; bHLHa38
• NCBI Protein Information: twist-related protein 1
• UniProt Protein Name: Twist-related protein 1
• Protein Family: Twist-related protein
• UniProt Gene Name: TWIST1
• UniProt Synonym Gene Names: BHLHA38; TWIST; bHLHa38
• UniProt Entry Name: TWST1_HUMAN

NCBI Description

This gene encodes a basic helix-loop-helix (bHLH) transcription factor that plays an important role in embryonic development. The encoded protein forms both homodimers and heterodimers that bind to DNA E box sequences and regulate the transcription of genes involved in cranial suture closure during skull development. This protein may also regulate neural tube closure, limb development and brown fat metabolism. This gene is hypermethylated and overexpressed in multiple human cancers, and the encoded protein promotes tumor cell invasion and metastasis. Mutations in this gene cause Saethre-Chotzen syndrome in human patients, which is characterized by craniosynostosis, ptosis and hypertelorism. [provided by RefSeq, Aug 2017]