Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Mouse anti-Human THRSP Monoclonal Antibody | anti-THRSP antibody

THRSP (Thyroid Hormone-inducible Hepatic Protein, Spot 14 Protein, S14, MGC21659, S14, SPOT14) (FITC)

Gene Names
THRSP; S14; Lpgp; THRP; LPGP1; SPOT14
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
THRSP; Monoclonal Antibody; THRSP (Thyroid Hormone-inducible Hepatic Protein; Spot 14 Protein; S14; MGC21659; SPOT14) (FITC); anti-THRSP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes human THRSP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-THRSP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-85 from human THRSP (NP_003242) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged THRSP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged THRSP is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-THRSP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.9kDa (169aa), confirmed by MALDI-TOF
NCBI Official Full Name
thyroid hormone-inducible hepatic protein
NCBI Official Synonym Full Names
thyroid hormone responsive
NCBI Official Symbol
THRSP
NCBI Official Synonym Symbols
S14; Lpgp; THRP; LPGP1; SPOT14
NCBI Protein Information
thyroid hormone-inducible hepatic protein
UniProt Protein Name
Thyroid hormone-inducible hepatic protein
UniProt Gene Name
THRSP
UniProt Synonym Gene Names
S14; SPOT14
UniProt Entry Name
THRSP_HUMAN

NCBI Description

The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

THRSP: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. Belongs to the SPOT14 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11q14.1

Cellular Component: nucleoplasm; cytosol

Molecular Function: protein homodimerization activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; lipid metabolic process; regulation of lipid biosynthetic process

Research Articles on THRSP

Similar Products

Product Notes

The THRSP thrsp (Catalog #AAA6150105) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The THRSP (Thyroid Hormone-inducible Hepatic Protein, Spot 14 Protein, S14, MGC21659, S14, SPOT14) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THRSP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the THRSP thrsp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "THRSP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.