Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TARS monoclonal antibody, Western Blot analysis of TARS expression in HeLa,)

Mouse anti-Human TARS Monoclonal Antibody | anti-TARS antibody

TARS (Threonyl-tRNA Synthetase, Cytoplasmic, Threonine-tRNA Ligase, ThrRS, MGC9344) (FITC)

Gene Names
TARS; ThrRS
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TARS; Monoclonal Antibody; TARS (Threonyl-tRNA Synthetase; Cytoplasmic; Threonine-tRNA Ligase; ThrRS; MGC9344) (FITC); anti-TARS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A9
Specificity
Recognizes human TARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TARS antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa44-144 from human TARS (NP_689508) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TARS monoclonal antibody, Western Blot analysis of TARS expression in HeLa,)

Western Blot (WB) (TARS monoclonal antibody, Western Blot analysis of TARS expression in HeLa,)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TARS on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TARS on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])
Product Categories/Family for anti-TARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85.6kDa (743aa)
NCBI Official Full Name
threonine--tRNA ligase, cytoplasmic isoform 1
NCBI Official Synonym Full Names
threonyl-tRNA synthetase
NCBI Official Symbol
TARS
NCBI Official Synonym Symbols
ThrRS
NCBI Protein Information
threonine--tRNA ligase, cytoplasmic
UniProt Protein Name
Threonine--tRNA ligase, cytoplasmic
UniProt Gene Name
TARS
UniProt Synonym Gene Names
ThrRS
UniProt Entry Name
SYTC_HUMAN

NCBI Description

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family [provided by RefSeq, Jul 2008]

Uniprot Description

TARS: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family [provided by RefSeq, Jul 2008]

Protein type: EC 6.1.1.3; Translation; Ligase

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: cytoplasm; cytosol; actin cytoskeleton

Molecular Function: threonine-tRNA ligase activity; protein homodimerization activity; ATP binding

Biological Process: tRNA aminoacylation for protein translation; translation; threonyl-tRNA aminoacylation; gene expression

Research Articles on TARS

Similar Products

Product Notes

The TARS tars (Catalog #AAA6150031) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TARS (Threonyl-tRNA Synthetase, Cytoplasmic, Threonine-tRNA Ligase, ThrRS, MGC9344) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TARS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TARS tars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TARS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.