Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC27A1 is 3ng/ml as a capture antibody.)

Mouse anti-Human SLC27A1 Monoclonal Antibody | anti-SLC27A1 antibody

SLC27A1 (Solute Carrier Family 27 Member 1, ACSVL5, Long-chain Fatty Acid Transport Protein 1, Fatty Acid Transport Protein 1, FATP1, FATP-1, FATP) (FITC)

Gene Names
SLC27A1; FATP; FATP1; ACSVL5; FATP-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC27A1; Monoclonal Antibody; SLC27A1 (Solute Carrier Family 27 Member 1; ACSVL5; Long-chain Fatty Acid Transport Protein 1; Fatty Acid Transport Protein 1; FATP1; FATP-1; FATP) (FITC); EC=6.2.1.-; anti-SLC27A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G9
Specificity
Recognizes human SLC27A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SLC27A1 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa44-138 from human SLC27A1 (NP_940982) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEG*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC27A1 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC27A1 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC27A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,780 Da
NCBI Official Full Name
long-chain fatty acid transport protein 1
NCBI Official Synonym Full Names
solute carrier family 27 member 1
NCBI Official Symbol
SLC27A1
NCBI Official Synonym Symbols
FATP; FATP1; ACSVL5; FATP-1
NCBI Protein Information
long-chain fatty acid transport protein 1
UniProt Protein Name
Long-chain fatty acid transport protein 1
UniProt Gene Name
SLC27A1
UniProt Synonym Gene Names
ACSVL5; FATP1; FATP-1; Fatty acid transport protein 1

Uniprot Description

SLC27A1: Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. The LFCA import appears to be hormone-regulated in a tissue-specific manner. In adipocytes, but not myocytes, insulin induces a rapid translocation of FATP1 from intracellular compartments to the plasma membrane, paralleled by increased LFCA uptake. May act directly as a bona fide transporter, or alternatively, in a cytoplasmic or membrane- associated multimeric protein complex to trap and draw fatty acids towards accumulation. Plays a pivotal role in regulating available LFCA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation or triglyceride synthesis. May be involved in regulation of cholesterol metabolism. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: EC 6.2.1.-; Ligase; Lipid-binding; Membrane protein, integral; Mitochondrial; Vesicle

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: endoplasmic reticulum; integral component of membrane; membrane; plasma membrane

Molecular Function: fatty acid transmembrane transporter activity; long-chain-fatty-acid-CoA ligase activity; nucleotide binding; protein homodimerization activity; very long-chain fatty acid-CoA ligase activity

Biological Process: adiponectin-activated signaling pathway; cardiolipin biosynthetic process; long-chain fatty acid metabolic process; long-chain fatty acid transport; medium-chain fatty acid transport; phosphatidic acid biosynthetic process; phosphatidylcholine biosynthetic process; phosphatidylethanolamine biosynthetic process; phosphatidylglycerol biosynthetic process; phosphatidylinositol biosynthetic process; phosphatidylserine biosynthetic process; positive regulation of heat generation; regulation of lipid metabolic process; response to cold; response to insulin stimulus

Research Articles on SLC27A1

Similar Products

Product Notes

The SLC27A1 slc27a1 (Catalog #AAA6149722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC27A1 (Solute Carrier Family 27 Member 1, ACSVL5, Long-chain Fatty Acid Transport Protein 1, Fatty Acid Transport Protein 1, FATP1, FATP-1, FATP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC27A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC27A1 slc27a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC27A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.