Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SENP6 Monoclonal Antibody | anti-SENP6 antibody

SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (FITC)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SENP6; Monoclonal Antibody; SENP6 (Sentrin-specific Protease 6; Sentrin/SUMO-specific Protease SENP6; FKSG6; KIAA0797; SUMO-1-specific Protease 1; SSP1; SUSP1) (FITC); EC=3.4.22.68; anti-SENP6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B7
Specificity
Recognizes human SENP6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1112
Applicable Applications for anti-SENP6 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human SENP6 (NP_056386) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SENP6 monoclonal antibody. Western Blot analysis of SENP6 expression in IMR-32.)

Western Blot (WB) (SENP6 monoclonal antibody. Western Blot analysis of SENP6 expression in IMR-32.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SENP6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SENP6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SENP6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SENP6 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SENP6 antibody
References
1. Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex. Dou H, Huang C, Singh M, Carpenter PB, Yeh ET.Mol Cell. 2010 Aug 13;39(3):333-45. 2. SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress. Han Y, Huang C, Sun X, Xiang B, Wang M, Yeh ET, Chen Y, Li H, Shi G, Cang H, Sun Y, Wang J, Wang W, Gao F, Yi J.J Biol Chem. 2010 Apr 23;285(17):12906-15. Epub 2010 Feb 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
sentrin-specific protease 6 isoform 1
UniProt Protein Name
Sentrin-specific protease 6
Protein Family
UniProt Gene Name
SENP6
UniProt Synonym Gene Names
KIAA0797; SSP1; SUSP1
UniProt Entry Name
SENP6_HUMAN

Uniprot Description

SENP6: Protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Processes preferentially poly-SUMO2 and poly- SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Deconjugates SUMO1 from RXRA, leading to transcriptional activation. Involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation. Desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination. Belongs to the peptidase C48 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; SUMO-specific protease activity

Biological Process: protein desumoylation; protein sumoylation; proteolysis

Similar Products

Product Notes

The SENP6 senp6 (Catalog #AAA6149574) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SENP6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SENP6 senp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SENP6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.