Mouse anti-Human RAB7L1 Monoclonal Antibody | anti-RAB7L1 antibody

RAB7L1 (Rab-7-like Protein 1, Ras-related Protein Rab-7L1, RAB7L) (FITC)

Cat. Num. AAA6149183

• Gene Names: RAB29; RAB7L; RAB7L1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB7L1; Monoclonal Antibody; RAB7L1 (Rab-7-like Protein 1; Ras-related Protein Rab-7L1; RAB7L) (FITC); DKFZp686P1051; anti-RAB7L1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B8
• Specificity: Recognizes human RAB7L1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RAB7L1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-204 from human RAB7L1 (AAH02585) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RAB7L1 monoclonal antibody, Western Blot analysis of RAB7L1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of RAB7L1 expression in transfected 293T cell line by RAB7L1 monoclonal antibody. Lane 1: RAB7L1 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RAB7L1 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAB7L1 over-expressed 293 cell line, cotransfected with RAB7L1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB7L1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-RAB7L1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33876898
• NCBI GeneID: 8934
• Molecular Weight: 14,964 Da
• NCBI Official Full Name: Homo sapiens RAB7, member RAS oncogene family-like 1, mRNA
• NCBI Official Synonym Full Names: RAB29, member RAS oncogene family
• NCBI Official Symbol: RAB29
• NCBI Official Synonym Symbols: RAB7L; RAB7L1
• NCBI Protein Information: ras-related protein Rab-7L1