Mouse anti-Human RAB43 Monoclonal Antibody | anti-RAB43 antibody

RAB43 (Ras-related Protein Rab-43, RAB11B, Ras-related Protein Rab-41, RAB41) (FITC)

Cat. Num. AAA6149179

• Gene Names: ENPP7; NPP7; NPP-7; E-NPP 7; ALK-SMase
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB43; Monoclonal Antibody; RAB43 (Ras-related Protein Rab-43; RAB11B; Ras-related Protein Rab-41; RAB41) (FITC); MGC90481; anti-RAB43 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5G4
• Specificity: Recognizes human RAB43.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 458

• Applicable Applications for anti-RAB43 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa113-211 from human RAB43 (NP_940892) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(RAB43 monoclonal antibody Western Blot analysis of RAB43 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAB43 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RAB43 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RAB43 antibody

Antibodies; Enzymes; Phosphodiesterase

NCBI and Uniprot Product Information

• NCBI GI #: 30277686
• NCBI GeneID: 339221
• NCBI Accession #: AAH41453.2
• NCBI GenBank Nucleotide #: NM_198490
• NCBI Official Full Name: Ectonucleotide pyrophosphatase/phosphodiesterase 7
• NCBI Official Synonym Full Names: ectonucleotide pyrophosphatase/phosphodiesterase 7
• NCBI Official Symbol: ENPP7
• NCBI Official Synonym Symbols: NPP7; NPP-7; E-NPP 7; ALK-SMase
• NCBI Protein Information: ectonucleotide pyrophosphatase/phosphodiesterase family member 7
• Protein Family: Ras-related protein

NCBI Description

The protein encoded by this gene is an intestinal alkaline sphingomyelin phosphodiesterase that converts sphingomyelin to ceramide and phosphocholine. The encoded protein is anchored in the cell membrane, and it may function to protect the intestinal mucosa from inflammation and tumorigenesis. This protein is glycosylated and also exhibits lysophosphatidylcholine hydrolase activity. [provided by RefSeq, Oct 2016]