Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.31kD).)

Mouse anti-Human PDHK2 Monoclonal Antibody | anti-PDHK2 antibody

PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) (FITC)

Gene Names
PDK2; PDHK2; PDKII
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDHK2; Monoclonal Antibody; PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2; Mitochondrial; Pyruvate Dehydrogenase Kinase Isoform 2; PDH Kinase 2; PDKII; PDK2) (FITC); anti-PDHK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G1
Specificity
Recognizes human PDK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PDHK2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.8ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa187-276 from human PDK2 (AAH05811) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB)

(PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)

Western Blot (WB) (PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)

Western Blot (WB)

(Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody. Lane 1: PDK2 transfected lysate (46.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody. Lane 1: PDK2 transfected lysate (46.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PDHK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
38,864 Da
NCBI Official Full Name
Homo sapiens pyruvate dehydrogenase kinase, isozyme 2, mRNA
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 2
NCBI Official Symbol
PDK2
NCBI Official Synonym Symbols
PDHK2; PDKII
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 2
UniProt Protein Name
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial
UniProt Gene Name
PDK2
UniProt Synonym Gene Names
PDHK2; PDH kinase 2; PDKII
UniProt Entry Name
PDK2_HUMAN

NCBI Description

This gene encodes a member of the pyruvate dehydrogenase kinase family. The encoded protein phosphorylates pyruvate dehydrogenase, down-regulating the activity of the mitochondrial pyruvate dehydrogenase complex. Overexpression of this gene may play a role in both cancer and diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

PDHK2: an atypical protein kinase associated with the mitochondrial matrix. The PDHKs play crucial roles in switching metabolic flux from oxidative phosphorylation towards glycolysis. PDHK2 is expressed in all tissues. Contains a HATPase_c catalytic domain, found in several ATP-binding proteins including protein histidine kinases (PHKs), PHDKs, DNA gyrase B, topoisomerases, heat shock proteins, and DNA mismatch repair proteins. PDHK regulates glucose oxidation through inhibitory phosphorylation of the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex (PDHC) at any one of 3 inhibitory serine residues. Inhibitory sites 1, 2, and 3 correspond to S293, S300, and S232 in human PDHA1, respectively. Four PDHK isoenzymes have been described, each with different site specificity: all four phosphorylate sites 1 and 2 but at different rates; for site 1 PDHK2 >PDHK4 >PDHK1 >PDHK3; for site 2, PDHK3> PDHK4 > PDHK2 > PDHK1. Only PDHK1 phosphorylates site 3. PDHKs are recruited to the PDHC by binding to a lipoyl group covalently attached to the inner lipoyl domain of the E2 component. PDHA1 deficiency is the most common enzyme defect in patients with primary lactic acidosis. Suppression of PDH by PDHK inhibits the conversion of pyruvate to acetyl-CoA, attenuates mitochondrial respiration, and may contribute to the increased lactate production observed in many tumors. The PDH pathway is repressed in a majority of non-small cell lung carcinomas. Inhibited by AZD7545, dichloroacetate (DCA), and radicicol. Radicicol inhibits kinase activity by binding directly to the ATP-binding pocket of PDHK, similar to HSP90 from the same ATPase/kinase superfamily.

Protein type: Mitochondrial; Protein kinase, atypical; EC 2.7.11.2; Kinase, protein; ATYPICAL group; PDHK family; PDHK subfamily

Chromosomal Location of Human Ortholog: 17q21.33

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; mitochondrial pyruvate dehydrogenase complex

Molecular Function: protein homodimerization activity; pyruvate dehydrogenase (acetyl-transferring) kinase activity; ATP binding; protein kinase activity

Biological Process: cellular metabolic process; insulin receptor signaling pathway; regulation of pH; glucose metabolic process; regulation of acetyl-CoA biosynthetic process from pyruvate; regulation of gluconeogenesis; cellular response to nutrient; glucose homeostasis; pyruvate metabolic process; protein amino acid phosphorylation

Research Articles on PDHK2

Similar Products

Product Notes

The PDHK2 pdk2 (Catalog #AAA6148765) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDHK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.8ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDHK2 pdk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDHK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.