Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human PAK1 Monoclonal Antibody | anti-PAK1 antibody

PAK1 (Serine/Threonine-protein Kinase PAK 1, Alpha-PAK, p21-activated Kinase 1, PAK-1, p65-PAK, MGC130000, MGC130001) (FITC)

Gene Names
PAK1; IDDMSSD; p65-PAK; PAKalpha; alpha-PAK
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAK1; Monoclonal Antibody; PAK1 (Serine/Threonine-protein Kinase PAK 1; Alpha-PAK; p21-activated Kinase 1; PAK-1; p65-PAK; MGC130000; MGC130001) (FITC); anti-PAK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D1
Specificity
Recognizes human PAK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
545
Applicable Applications for anti-PAK1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa191-280 from human PAK1 (NP_002567) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(PAK1 monoclonal antibody Western Blot analysis of PAK1 expression in HeLa NE.)

Western Blot (WB) (PAK1 monoclonal antibody Western Blot analysis of PAK1 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody. Lane 1: PAK1 transfected lysate (Predicted MW: 49.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody. Lane 1: PAK1 transfected lysate (Predicted MW: 49.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PAK1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAK1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PAK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase PAK 1 isoform 2
NCBI Official Synonym Full Names
p21 (RAC1) activated kinase 1
NCBI Official Symbol
PAK1
NCBI Official Synonym Symbols
IDDMSSD; p65-PAK; PAKalpha; alpha-PAK
NCBI Protein Information
serine/threonine-protein kinase PAK 1
UniProt Protein Name
Serine/threonine-protein kinase PAK 1
UniProt Gene Name
PAK1
UniProt Synonym Gene Names
PAK-1
UniProt Entry Name
PAK1_HUMAN

NCBI Description

This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Uniprot Description

PAK1: a protein kinase of the STE20 family that regulates cell motility and morphology. Critical RhoGTPase effector that regulates cytoskeleton reorganization, the JNK MAPK pathway, and nuclear signaling. Binding of Rac/cdc42 to the PBD of PAK1 causes autophosphorylation and conformational change. Phosphorylated and activated by PDK.

Protein type: EC 2.7.11.1; Protein kinase, STE; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; PAKA subfamily

Chromosomal Location of Human Ortholog: 11q13-q14

Cellular Component: Golgi apparatus; nuclear membrane; focal adhesion; protein complex; dendrite; intercellular junction; Z disc; cytosol; filamentous actin; ruffle; growth cone; axon; cytoplasm; plasma membrane

Molecular Function: collagen binding; protein serine/threonine kinase activity; protein binding; protein kinase binding; ATP binding; receptor signaling protein serine/threonine kinase activity; protein kinase activity

Biological Process: axon guidance; positive regulation of JNK activity; exocytosis; wound healing; apoptosis; protein amino acid autophosphorylation; positive regulation of estrogen receptor signaling pathway; receptor clustering; T cell receptor signaling pathway; protein amino acid phosphorylation; positive regulation of stress fiber formation; ephrin receptor signaling pathway; dendrite development; neuromuscular junction development; MAPKKK cascade; positive regulation of peptidyl-serine phosphorylation; cellular response to insulin stimulus; branching morphogenesis of a tube; actin cytoskeleton reorganization; T cell costimulation; response to hypoxia; innate immune response; positive regulation of protein amino acid phosphorylation; mitotic cell cycle; vascular endothelial growth factor receptor signaling pathway; neurite morphogenesis

Research Articles on PAK1

Similar Products

Product Notes

The PAK1 pak1 (Catalog #AAA6148655) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAK1 (Serine/Threonine-protein Kinase PAK 1, Alpha-PAK, p21-activated Kinase 1, PAK-1, p65-PAK, MGC130000, MGC130001) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAK1 pak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.